ELF44 (444\\pp=0(ppPtdjj,,Qtd/lib/ld-linux.so.2Z?DS^lW /ky\w;C=v Lg : Kt z~r%fai2p}U9|Fn-TuxAY"7!,'P4)O b[> jG_(Jd0HIQ N@q`o{e6<$h8c*RV5mBX3 s1M]& E.+#p)4 ݣkĉ( K8Vۓdi9fUaĹ@|2LZN bMjx::;q >1, pMyo  )x&TL\ulE[s#7k"6`w=K#TGT8a/n~Sdu*"YxgZFg)`?Mfa'N1LN#V5 .jc+ED.05g=B]B`T y9%>$qy,d{qUjU`v!`v!v  DvĹT~dv`v9ļ@vETvlibc.so.6_IO_stdin_usedklogctldprintfsetuidchrootsocketmkdtempfflushstrcpysigsuspendvasprintffchmodfnmatchgnu_dev_major_IO_putcsrandttyname_rstrsignalstrncmpinet_atonoptindstrrchrwaitisalpharegexecpipeconnectgetpwuidftruncate64closedirinet_ntoaisblankgetgrgidstrncpysigprocmaskregfreesigfillsetunlinkputcharlistenselectmkdirreallocfsyncstdinstrtoll_exitvsprintfmemchrstrpbrkmemrchrtolowergetpidkillstrspnstrdupstrftimelocaltime_rstrtodisspacestrtokstrtolisattylchownsetmntentclearenvfeofstrchrnulswapoffsyslogsymlinkisprintcfsetispeedfgetcrebootexeclpfgetsgetpwnamgetppidstrlenungetcisxdigitpivot_rootsigemptysetopenloggetaddrinfodirnamecfgetospeedisalnumgetcharstrstrstrcspnislower__errno_locationrmdirbindtcsetattrfseekchdirmemcmpgetnameinfogetpagesizegetoptdup2clearerrunsetenvstrptime_setjmpvsnprintfpollsigaddsetctimegetgrnamsethostnameputenv__sigsetjmpstdoutgethostbyaddrfputcinet_addrfputsregerrorfreopen64fclosetcsetpgrpgetmntentstrtoulvprintfsetsockoptmallocsiglongjmpkillpgstrcatumaskstrcasecmpftello64realpathraisesetpgidgetgidisupperopendirgetenvsscanfrecvfromregcompoptarggetservbynamestderrsigdelsetioctlalarmsystemsetrlimit64wait3gethostbynamegetgroupsgetuidreadlinkfscanfexecvegetegidgetopt_longexecvpstrncasecmpif_nametoindexstrncatstrtoullfilenousleepgetcwdfwritefreadsigactionrenamemkstemp64gnu_dev_minorgeteuidatofsetlinebufatoistimewaitpidlocaltimeswaponlseek64umountstrchrendmntentgetsocknameutimesendtovforkmktimefdopenreaddir64qsorthstrerrortcgetattrstatfs64times__ctype_toupper_loc__ctype_tolower_locumount2syscallbsearchfreeaddrinfosetsidfcntlgetrlimit64cfsetospeedcfgetispeed__h_errno_locationgetmntent_runamememmovefopen64strsepaccess_IO_getcsysinfogetgrouplistsetgidsetbufstrcmptcgetpgrp__libc_start_mainferrorvfprintfbasenamecloselogsysconfgnu_dev_makedevispunct__environ__cxa_atexit__xstat64__fxstat64__lxstat64__xmknod__gmon_start__GLIBC_2.1.1GLIBC_2.2.3GLIBC_2.3GLIBC_2.3.4GLIBC_2.2.4GLIBC_2.3.3GLIBC_2.2GLIBC_2.2.1GLIBC_2.1.3GLIBC_2.1GLIBC_2.0       qi ;si Gii Sti ]ti isi uii qi si ii ii p$@v Dv`v dvvv ppqqq qqqq q q $q (q ,q0q4q8qq@qAqBqCqDrErFrG rHrIrJrKrL rM$rN(rO,rP0rQ4rR8rS:X[5p%p%ph%ph%qh%qh%qh % qh(%qh0%qh8p%qh@`%qhHP% qhP@%$qhX0%(qh` %,qhh%0qhp%4qhx%8qh%L$_XKS~Yx$)9| xu y1\;;uij#huP_ZtFAF{[[^_S\$ h|Z8-u@%ڣ9{/Sj/PZYtX[Sj/PZYt 9uxtX[S/u H9t8/t[VS։t8tPZ\9t1ۉ[^átPoX5tUWVSw 1=v# 1k  G w=w1Ҿ ՉÉ$uzf1< td1҉1f < At 1҉1< At 1Acv[1< td1҉1f < At 1$1A/1< tؽ 1A.A$AD$8AZY[^_]UWVSӃ tPD$1ʚ; $1҉u uu $t&ƒ0EC)׉1ҹ D$|$ uƒ [^_]Åt y-BI vtvù vvWVS1ۃ- N $Ɋp X $p LXCuσx[^_Pjj WVSӃ$D$RhTPT t9f<$uhYt PZf$$f=-uvf$$t?f|$uhYt PqZfD$fD$f=-uvfD$PD$[^[^_VS0jPV t S1^[^jRP jjP SjPPjS[QRPZ y D$uSQRP> y D$[VSt$t$t$ yt$0jD$X[^St$t$t$ y"\$0.ډD$[SRPZYt Sh[t$t$jQRPy hjQRP t hNQRPU y h +4SPZu Sh[SÃPZuShD$[X$Y[SPYt Sh*[SPZt ShL[PYt hVjRPk t h ÃD$ Pt$ D$P y h$Y5vZt hXCS5vSYYBu@u SY[5vPrZYSPFZt Shdf[ávXUWV΍}S?WQRPMuuu VShrh~e[^_]St9t h[SÃRT$@T$[[[SRPfZY9t h6[9St SB[[PZt h VSRPlZYt VSh[^SPZt Sh[SÃQRP yShD$r[X$Y[ùSQRP y Shy[ùSRPZYu ShR[ÅtPfZu h1SRPYZut h[SPYut hx[WVƃ?tHGu)A $ $^^_Sj=PEZYu SY‰)PSXZ[WSlى1[_SÃPZuthD$X$[[UWVS}W DžuDžDžDž11| vtw}h%x-9}h9Xt:3փq) t Rލe؉[^_]UWjjY_}UWVS}wEE tVSEUXZEUe[^_]VSt$\$ VS9u9tBu@t h[^D$T$1PËD$T$1@^UWVS1yu )ƅu߉[^_]áS\$ 1tRZD$[PhUYXáS\$ 1tRXZD$PhUUW=VSUVS" y?t[^_]UWVS1 }u t )ƅu܉[^_]VSSwZ[^ÃjPL$T$ ZYT$ $xYZÅSty9t h[ÃT$D$ZUWVSÃy : tY[[^_]Ã$fD$UWVSÃ-WVS y(1҅)׋Ut th:D$.Y$Z[^_]UW=VSUVSb y?t[^_]UWVSÃ= ?T$t"Ѓ@~Ѓƀt1Ejd[^_]VSÃ҉$t3wӕ $1hדuP$SZYt hX[^WVSt$PhV$m=@v藡 :dutb8j.W[ZYtWit6]t$8tY@OVPPh Vu۰ (t $ t 1҉P^[1[^_UWVSPt$dD$hVҍX~&H9-uyauyu ,VX1t%1ɺ,t$ D$D$@D$ $?-uG*(%PWYZu"Uu'OWhEuԊMD$L$T0>EL$ D$ƒ u ;utd$@-(D$D$ D$ D$tm3fD$@fD$BhhV"_Zu D$D%hVZY1҉V@D$DT$L$ 4$Bjj3L$ QD D$0h!T$(RL$APt$, |$y%1ҍD$ :@ʊuftx-tQD$@tJh(D$ L$$@ Etf D$0f!D$0h5D$ L$$;1P[^_]É9Ht uÈ0 vJwBUW1VSÍjf]w(Ct:u u#" =vCD=1;:GÊt~1[^_]É 9Ht uUWV1Sf $ٍ{Ѓ vy{v AwB{@MЃ vKwM 3KwM t:u't@$ 21ɀ8:FȊt i1Z[^_]WVSvWCP[Y^tD|[uƍ@ۉuv^҉tr5v0[^_UWVSD$jjj` yhYmD$ډ߉$D$hy%@9<$tŋ|$1 ;$|1Vt$XZ_][^_]UWVS1ہ=wD$ auw_&赤u 5Ph\$SUhSh4S D$h?S[^D$CD$4DP Yu\$C|$<:tt-GPZt+D$<$ƄD$Ƅ$D$$É1󫍃PPPPPPPPPPPPPPRPD$D4D$L@PH|$tM|$u(ǃǃǃǃǃǃǃǃ|$ t#$Pt$tҋCuPs h W ? h  h3 thr_]h h hZYtht]XC$t Ph_^_h S jY{2u{(u C0tth C2ZtPh ]XC0f=vPh( ^_C(ts,Ph<  C3tPhL Y[ Z [^_]} VSuY=vu1uxa5v)xLFu =,t3u26u1(X1x :Ɖx[^UŃ=vWVSu1v=v1ۉDCPhY V uG/v[^_]fJfv_ Ã1FeSÃ5vT$f X_ I$fwcvZ[S5vRCPCPCPCPCPPhj  [vVSjjf5D$XUL$Y!@&҈utD$X!D$H$<$1ڀ΀󫋄$$fD$HD$LD$H[$ڀ@Ƌ$D$LD$Hm[$袸T$\RPWVhC%V躼W贼 |$D$tPt$lt$tt$|h_%Pt$|$$hp%UiĐ[^_]UWVSt$%h%SY_th%S]Zu#uҍD$pPh%$S tht$tw^_@v$$8u"؉ڃ%i1O$$&D$<$8,D$lT$l9&T$l: \$1߹h:T$lj/W譸ZYt3 1ҍ@1跑ffT$0fD$,T$ ZyWt/t@fD$/uF3)PWOW KF3j@sYC^t SS@C[^_UWVS}EuExx x(x$xxwwxxx x t@=,xu7xdxxxSQkdRPdvdS5 xh&5Dv`1ɸUu1~J޹d1҉eÍ@ك))İ*T$h$dVRh'5Dvexxxx1 A |=wC'QPh'5Dv谺裄x x+$x; x|4; xv* xx$x x xv(x1҃(xv 5Dvh'h)؋xáxۋ5x=xUxExUE~'|"v+u}9}|9uw =,xt5Dvh#'[^Luu܍<WP)ڻ<ЙЙRPQh0'5Dv膹}u-jxx5Dvj  }u6jԶYEe[^_]WVS\$tu$dRPhM'WWWsWhS u hT'hJ(SٸZYt0 wĀ> u& [^_WVSÃRhP艱 څuB< t< uT$FD$P8Zuڀ|$-tӀ|$.t̀|$:trPhk'LFOF< tt < uW胱^ @u1ۉ[[^_U-WVSVҵEVhS诰uV蠻Yt}t͉[^_]UWVST$ujBY=,xw|w f=,xu,$V?VSjt$gD$)tVZt 8t‹$)V]tgh D$ؙ_ W$=-xt)wwl$wwW| 3=-x5=,xt6D$\$jjS1 w ʣwuuj[[^_]UWVSP] jjEPEPEPEPh'SEEWE' fH U@vhh2u^_t,}'u'P[t8t Uг+E1ۉE܋EĉEu0EEtX򍅼Z}u (E{1҉ƍP1_=tFPhUj:u&Y[tCUW(Z=t4=KuWډ([=tPh(%1S)SUS)CZY=u<1ҹ (ww8uy h)R-x1S*)_=tAPh*)j)S賩ZYtj,S蜩Y_t1ҹ@j,St_Zt1@fxxщǡx t:RPhF)SȤ1҉S=^uxx)wwUSP)Y=~APhV)h/)y(EҁA 9tGW 11S]_Z=tPh[)S1Ҹi)/[e1[^_]UWVS$RY=~}=Š$ وB:ljZ[^_]1|,%u6$d=q4@4PffP=8u1ɺm*<58>)1w11< 1nD$ L$L$ u$DŽ$D$)؅$~XsD$$Pjj$RD$@P肩}" 9u s+\$hz*hS=www$11;$}u D$ T$D$ >u1*@ th* DC]yh*C^$ 1;$}L$T$D$ $E)whw1ۃ<~ L$T$w~L$1ҋD$ Sh*1]C)1Y w $ ts h*CwYH<w:$5w)1 w=w#T$D$>h*BZw҈T$huщЃɈL$A|$u D$s D$D$|$u20iPh+B$(RwHq+\$Ã|$T$ L$ T$9|$jhD$@P] 5D$uh'+_wts tYMZ8B6D$kuhO+T$ T$ 1ۋL$ wD$D$,L$ D$11<s3D$uhg+(Xff w t~5(11hD$4W ubh+@L$0T$D$ =w^t )1w1T$1w$ D$T$ (t$,SPh+%@L$<+L$ =wt*D$1w6tT$D$ct D$D$ T$T$ 1|<lh+?D$ ,z=w[t )1d111j艥L$ wD$L$Y1ۀ=-t 5,Z<[^_]É1t LD@ uUWVS1ۃPl,$T$h,1[juHAu3%uL$׉%u3 $@q)x9uA4uQ 1ZY[^_]WVS.K0~Ph#-Y1^_ljSDC[^_VSИ*8u#T$t$n.T$T$~KuRhM-1[^ZY[^S1Ƀ كufD$D$D$uZ[UWVS$L$jjj y y.t$w1D$fD$l$ ffD$ jVS @u.;1D$0ffD$ D$,fD$D$ jVS膗 @u .$$ؿSz]y h.WY[[^_]UWVST$$L$ jjj& y y.<$D$|$1T$$ױ󫋄$|$,fDŽ$fDŽ$$Ƅ$E$fEf$j$QSß y .L$T$ $fL$$fT$$@ffD$&D$L$ D$fD$(,fD$,fD$@D$ED$@fD$*D$fD$j$Pjh@T$ RSSYy h.W胺XZĴ[^_]WVSÉ1ډft迺xScScth.:[5;u0<t xujh.P ufK [^_WSÉ1w dtCC5ǃcScƃ[_SYSYSYS QRh.P舔[UWVS˃ @$:QxYn.$@OЉD$DYD$Sh.P-\$ n S$$d:غ$dL/C؉$d3>.u.PS输XZ ffPhxb:ffPh1(ffPhffPh.S^  $$> ,$OF1D$ $MMFL@9$y~`L$UWh.S$dÉ1l$ Ã<$),$<$~ C9,$D$ [^_]UWVSà =0T$ 9u D$ 1o11!щ؈ $ $t 1tG?јuԃ{4؃D$ tD$ D$ u{lu{, 衴5(h.菱P蠛 Df-K.wG wkD$јX|$vD$tRT$JP1YD$8u11ffBuRh.P U@ZD$l}u{|$t%&K/Pu谚]l$ u){lt#ClƃPh /nP| u#{,tCk,Sh/CPT 0D$D$D$ D$D$9jiѲ3觕^uW蚕[ [^_]Svډك1tT$vƒJuD$Z[W VSƉ1󫡰vƒxu؉v9}[^_øv踰vAv7v;#aD$D$jD$P5v譒 Ht h!/GXYUWVSӃ7oo@u h4/@ډ/ot ff$fl$褭[^_]UWVS(t$$1T$臭$fD$É(t"4$hA/VhS胬uQD$E|$t#L$3hd/8u*D$T$|$<t7L$'hq/t SkD$T$<fD$fBSM1,[^_]UWVS\$\$pT$hj jD$` uh谲^m@uh/蔲X8t$1D$fD$ T$fK\$DT$ߋ$fD$fD$fL$fL$"D$FT$.T$tfD$D$D$fD$l$$^jSjju[^_Stt 1@ ![UWVS$~h16Hy$)Ésv-]Zy 7ut߉Չ3$[[^_]ËD$@D$V5SXT3v jP|YXD3[^UWVS5u ~uW 8ӃIt. tt6,t!t ~(u~u~+t ~(~)uoT.3u4D$PjWT$ 1 $um|$u~)t Gv8tPtKD$tt"(D$D$@DŽ$PDZD$T$0L\.3Đ[^_]VSxwPS辂V؁ @xw[^VS1ۅtw<tw$FCFCmF F C F@F OC FY+FuCFhCF F XC FCFGC[^WVS=twG;twFG6u$Y[^_ÉЃt tQCyZ1ɃS~ v""vvQCPh1Rjxv[h4jjhPyh4jj'h\PyRPJYZRPFtYZSC (J{tt.u%{u1{(ujjyjj1 hPJPPu @ tÃT$HAHRt$t$t$TzD$D$VSÉЃtSuƅt tstntiPT$}Pj S$҉yIh1jSm/u0օtRh1jSPh1jS<ƃ 1Y[^Ã=TwWVS9Lw$WF@FDw8P{=DwX5=Dwu9Hw~ TwrTwDwLw`TwDwDwt 9Z}Tw5#F@FTw8Pr{Tw8M_Tw8u9X~X[^_UWVSÃPBP${ 1$kMW;$tR{X F9yC 9tP{YcZ[^_]Soø;tPBP1[á uSXPBPS tA u@@< t< u wC;BtPuzYC ` C @ t@s uSPSP P 9tS9zZ[S uPBPCxPZs zXH{uS uy[[= uvuË SYCYRP.tY[[vPBP5Dv$zXuDvSu'0wtxu1ƃ1[UWVS@=wtPD$@PjQ| PBP0wcxtZP1H $k T$$9u t$-u$~ut$1C h 8j=VeZYu+t[ jjVs }C WS WSO t 1҉#{ww$0$.[1^[^_]Su Sh:Sk[[Ã=wwBtwSt1[ËCt wWVSBtyË5 1;!áPBP)~~t7fXKyN1u1[^_RPfZYt h2VSáPBP 1e{t%CtuCtjjX{u[^UWVwS9>-}.jh2db[DžXyKt=SGgYtj jShm xWjZx1~SgDžXyh2E)Yo9t jjiXZɸ=$wMC9}WjeY_S5$wuVS'eVjey1 S1jZuw[^_]SwC(@9t#wC)eC2[UWVSӃL$PT$BP u@~Pi u@XD$|$uR|$tK;uFsh6vmY_u0~u*f$$A󥉂5|$D$|$JtA8t\D$f|$.tx.tYjPRVT$f T$u>tRSa`wCYX%يBD$A|$t/T$DB u W`ZuWb[uL$A/p[^_]øwPwP WVS։u@1ҹ @x:uC *>-u~u C t `3C[^_UWVS-M 9s h w뀋EuP9ueU9t^PBP5S>/(PDF FV^VPVP@ t98t_[^_]f؉ $ $EX^[^_]W=VS+wG)9s%G[^_UWVSӃ؋t:JtۉʃR€D$:u"T$D$\T$ T$ 1ҋ<$D$G<$t@$ϊ Bu$D$d$t"@8w [^_]VSÅ;w@$t33J337f3&[C3⾨3C[vaz[d3hCN3VC{ t63>s ƻ383&s8$3C3s3V3C 3C뺋C3CC 1[^[[C@}3s['CT3\C B3J[uջ8룾33`] 3fCNn<wC 1n[^[[^VS,u t{t [u[^UWVSÃPj'ST$_^_$)ݍEy'@'>'Wu,CA;'tAމ $N" $@)"W;u@[[^_]SË@qPsh3 [UWVSzt11ۡ w4 6uu1j=CPS^Zu4u Sh8h45Dv[{^t@D$[ 0‹A@At!F u vUYD$nf F*$ƉOFD$CF$2Q:]Z[^_]UWVS$h:P]]Z$u>PW)_$Dt uf>ZD$#t D$@D$KJD$u$4|$t|$u=wu 14l|$t u@vL4T$=|$wu7>D$,u|$+uD$+w$(wD$)G)B5ww\|$auÃ$@u à tT$9+$$%=u$9 F t9uL$$A@At8t8 u u u@ww$1>t VP_ǸY|$,t5@g>u|u&u|r>u@*^ tB&t8@wp-uw@  x~5ww=;{tL(tL_tdPoF^u4C߃w r"'uD$# D$$@D$>(u@(!D$"T$׉Ջ@G{D$,B1#u}þ A_tPEYt.2=`_tPgOZuKCЃ w؉|PЃ vC߃w s ]EW X41=D$%t[#t[6/te:u,$t:t @н w1 \1Sh:FY[tT$34@9u$F&/u 11 1|$u|$t̀+|$, @8D$|$u |$D$D$"wD$4T$2PJZt+$$PH$$wPjRrLPBPl$DŽ$$+kt鉄$$$$sP$ T$4P*|$"p=wt  l` \tZ6 u u@=wt뎃`t$\t$tK"u|$u\dƁ~) u@vi4 u@ww($1R9t )$($(ËuD1҉D$"wt ww$ $|$"tw t xp|$"t }w9kv$$[t9$$߉PBP$$P`FDŽ$(7]T$2w$ P|$u|$tC\$D$|$uDD$T$D$1|$tB"T$D$D$@ D$D$T$(BT$,[^_]þ UWVSww^=wt eCk {8FU0|wPwP SB ^u[^_]À=wWVStww=wt ߾ u@v4 t t=t#u t=u˃\u; t ߿ uB@B=wvt_=:tS u u@wwSh:AZYt=-:~9؉u^>u&t::wj11҉_[^_Swu2Ãtug=wu^wt!wtÁw4wt+wSt@8{qw[WVSwWt<=w5wu=wCt >[^_]UWVS@ +t -1ۃ-rwRt-u~t u@-@,8;Ftcu D$p[owtW1H@PRT$th5D$5Uuۉ|$tW2^t=5w>u85蚬D$uD$:XD$ D$D$D$T$#YQHT$#tۃ|$ t |$u\u D$ 밀 u1Ut$ T$-ZY$D$t*t&UT$,Y$iu f[|$ntK~tED$;X uTjD$p6D$/P},D$X1‰GÉD$ ;X uáKh9w%RT$,Z$tRt$ ,ZYujU6q$ jSP] u$[^_]SzZu h5;u [SBӅtsh:豾w9~8c|w@w1[UWV1SjJtPBPj/D$P/wZYuqt[t$D$1Ҋ:k@=1}u :@AuB,@u@D$P4t$h6]Xy0 w3D$PЀv wh:;T$CDЉD$;u4D$T$%D$"u Sh6[D$%P._1[^_]U1WfVS0&StatHu Ǹ6T$NT$uĻC9uw8uxt h&6j h1W4 h$D$\$9kD$ D$ \$$$ډD$AЋL$T$\$$ $T$\$G/~9~ɋ\$t h96){$T$ t1D$T$_tKl$ 1UPR3ShD6S.Y\$uzD$D$|$ WP3XZtKtT$L$T$(L$,tD$T$D$ T$$D$ PP&[^yhK6ى蝵01[^_]D$D$wWǡVSPBPjW-'ÅXZyWh % OS/[y hd6轺Btл u@5 u~^u  诺F u@@ @6[^_UWVS=G$5wuB1,0t%-‰$$RPh|6? CAu~Ftt1py 6h6ҹE@Et;-u {u1 iËT$G,tD$)D$T$\Xt&Q -l$uY1[[^_]UWVSl^D$wu9;-u${u2L$Åu $/šPtG $9sVT$*_$ >/‹Axtz/t/B9v'x//EB~/u~/t/EBxhGU88.u!H.uxt Jz/t9wt /PhGjT$-ZY$u9׃@u1PN+]uL载dw=uj|+ HtuH u~@ u܃9uݩt |$h6Sh6D$tp h: ZYl1[^_]ËT$L$ D$蠶UWVS T$1ɺ aD$j/S#^ZtQL$؉\0LMy'=wuL$:tu؉$$֋D$uV ww7ӧP7h6jSzZt)@(@) 1ɋ؃1[11HR!t 迠áWVSP!t 襠$w;u#0wu1qxt H@ݿ8%t$V50wt8NV Ik 9tv1L~tN^ǃ;u[^_UWVS1Ƀ T$P |$@wSDwTw<>Rt$T$ !ZY$uw|$uRh: Y[1ۅÅt9u wx}wh\w|$\wuOL$D$A9s@><>/Ut$z YZt!Uh:i ]Zu t w1붍w뱉T$D$B9*|$u ;t߸x\w\w\w-Xw\wXw}&u}h:s*Y^tjE=\w@EC1ҹs$Z=}_`w5`w ";sXtV!^ߤ\w9u\w1҉C\w*1҉ Bu蹠‹u\w0&t1@X\w\w=Dwt9PBPDwPX!YۉuTwDw\wXwtL$Q\wA [^_]VSÃ$t$<|q<~<iC $@CMCtF$t@Wu{t h6覰뺋$P[s[^[^UWVSÁ T$ @UPBPD$ $t`1@1ɀtu J$  $P qPH JQ@D@NuD$D$kPw.s 9$聚 V<<{$jWYƅXhhBx.{T$pRW5*^Zu#$%=uhhhjAW$ L$QP*ZYuBD$ %=t2T$t;T$D$pu$;D$u$;T$l$u ;D$h(V~#]hhA hhAW D$pP&^y h6:;u(C pV Y=wD$tr=111\u{t$p"`VLBjj  C ;t$tuP11҉sS PWh66$PWh73$ӗu7$轗twj jU_$ u2: u2xV!X 9Uh2Ǭ$苗t@u|$D$$l |@D$yC yt6U-$9t ܹu;tV=!_M½;[T|$xD$ t L$H[^_]ST$$B$B$D$PZuD$BT$$.$ۡPtx"tjRH$PPu @ t؁Ĭ[UWVS1ہ$P$PT$T$PR_t#z"O$JPr$<w($W j$pU[1ۀ=w^$Bt$Bu#$P$pwZY11 z%t{$tpl]e^XH $P$r]X1=w9 =w$@$81$$^_j$r2=wY[=wt$1۸8R ҉$u$xpPBPlwpw3-lwpw=Í@tw,+-xwܙ肩xu@8^1FF 蘛w1ۋ$P wt w^=G!tQG!ws|t6ut#D.u $ $ wuCAu$t aT$PPu @ t臚Ĩ[^_]UWVSÉЁL$$D$T$ D$9t@D$9uD$9D$ ;u Cu؀8~ǃ+w /t":ttuGuHxuh9T$}Y$QT$R Z$tTptM>tHu肎t)Љ%F|$5uFE޻FG9rL$/S $T$}t8\$8C|$ t,|$t%|$<jP"=wXZu1hu1!w[^_WVSZtOzrt:=G‰Hۉt 譴1褴+GaúPw[^_Sw$D$P [tx"uAw$5T$Ptǀ1҉SPYu14$UWV1S=wtDv{(!'u%1ZtVdu{'tG7@F{*uл1jPi]X脏wsw1[^_]UWVSӃĀL$j/PZYt+D$CtD$ PU]_]  $9҅҉T$uL$h17PI Y^tL$ 1҉褗t4PJw ҋD$t D$1 ~ wD$ t, D$t D$  =ut ~ t~u uD$VT$D$D$D$D$D$b~wD$tHh7RT$YZ$t|$ {|$h:7R~YZT$9T$3?/u.9T$uD$ PWYZxЋD$0%=t =wtRW Z@E1 1҉txt WUh?74}|$u T$PBP蘕@D$D$D$ꍄ$ձ|$t t迎D$tD$7莆PUh6w L|$u T$ S9PBP@D$ F+FF FC[^_]UWVS Bt8-u 1 T$D$$D$ D$p D$ttT71҉{t'uh7Չpho71҉t@D$GD$T$t$]D$<tS<tZl$xڍD$(‰${M$yӅtP7uD$SPh70 U7u+'t#D$7uD$ Ph7[_#t#7߈vj諈1 D$D$D$D$ [^_]U_WVSt 1qw5 8t 1ۍl$ =dw$D$eZ{uRkD$C D$T$D$‰$zM$y{ D$tOPRh7 udw|9r1]1҉:t@t <u=ux胋PX|$ uww8u[^_]U1WVS|$,W@uJAJ肓- D$_S:u5Bt.@$}$tB1ɋ@RT$ *YD$;tD$P ZyVh6蘐OSD$uXR|$x t$[_~jVNVH D$~jP4t$+ D$0PsxVYD$t$tPZuD$w轂[^_]UWVS|wD$T$C{ ޓuD$X1- D$xj/S^_uUڍt$ |$xVRT$d ZY$uD$%=t%9txډ wtu Sv=w=wYXuv[ w^w_UWVS5 $$wL$ T$󥉄$D$PZulPBPP $T$PwC$w5{D$HD$ C$PD$P_XC@C$% wzu\$ywsu|$s s ђ^FC$ u Fɍ1~ tj=s ZY@Fu v_CFC FS[wy$$ w؉t󥋔$P"z%w[^_]UWVS\$t$;Cutt4PBPZډBu"ytC1GVs]1uُ[^_]wuyUWVS0\$DD$]oT$(D$(T$,C=ws^D$(@D$D$ oC 1ɺ@wGTw}*uEU3E3U ܀}Ku1U9UEEM9M}t},u!M̋UE ^T}t} u M̋EU 11(}+u*U9UEE|lM9M^} u*E9EEEӀ;tShUPH 3jjjNjjjCh;j D$ͲVS0 wSd[PSZYuF u[^UWVS l$$ laD$D$PD$ Ph;U}jƃ҃ Rt$ tl|$F<.tu|uHy Wh;.FuyWh;h; á@v9D$ t+Gwt < u =wthwhUS 5dvh hw uQt11<$6uZ|WR6hXŋD$P> >uEUhUSi  1[^_]W1VnSpT$fD$h[<t$V[<@_ÅXtlډQSYD$t$P1ɺnahh[<|[^_UWVSÃpUR|5YE~x(u jZ9^^pXhhA 3 Cy< ;'iyM؋US-_URPi1Y^uE1%=ˆSUPC {9C{tve3Z)čT$)ăU{t$OW3h;VCtOW3h;u+VuV3s]ejjs CMUs40se[^_]UWVSÃ~z uz uz :u z :uz t|$W?W]xX D$׃GtVWh6$PauBh9Hu ݸu'79htQRh<jD$P 0uٸ|uuSh <jD$ PVT$Rp $Wh<PD$$4[^_]É1ɸ.UWVS$/ljD$PD$PD$$PUD$0Ph#<t$T  <xtD$E tD$1ҹ B @tD$1ҹcٶB5%F j.PY^u cjӀӀjj5yD$0< C$D$$D$ ht$ t$ y=.hQ<-ZT#tŠ Jp tu5D$V$D$T$$$u8uBT$t L$  u u t^@AAl$UEl$uՉ;V} )D$;$r=.d<hd<.HWVSPD$PhO=t$( I=\vt4$jjk bujjj OD$ |$?D$@|$~D$D$t$PSD$ } hU=t81۾ u <ZYuEǁa>q>c؟cCu]=oci=cc= euvJcfuFv"^#t t ‰cVXtuWr^Cnuv`C/su!v1hLC vuC ha>Ut$ {uq>b=}b@vYT[^_]-fUWVSÃD$uWP$/4Vn@~Y^PD$Ph}>UtD$h>S]Zہ`uaD$x`$˰蘕RPSVAt8t Vh>9D$;wu!$;wuh`V[^VYXZ[^_]UWVSP$/hǍ.PZYwt1VS1D;_][^_]UPWVSh趮jN/$_@h6MPY[T$Gt$ t$ t$t$wojh>wtj_V#h>rj_Vh>Vh>h>th>h xtuh>ID$h>;ÅXZtO$>>T$y1-D|$ t!D$PSZYth}X $uUh>hVh>Wu|$th>W_]u 1҉t芯@¸>fh1[^_]ST$Ãu,5xj/S xt@Ax [UWVS8|$Lt]D$P@11jqƉ$D$+$T$RPh>t$t$wWVjh2?HwLxjhxPFV PX1xT$i3D$xFuޅt W1j͠ xt$x@ x x?Ȁ xD$,PD$,PD$,PD$,PVh??41ɉjOعwU؉j-ع _?eSKT1[^_]UWVS$D$j"^t2ЫD$ut$g[t$w8xVPwh8xj5w%DxOxNx 蹢D$ T$dvt_FD$H11D$LSdT$ RPUt$P$$R1$D$$bL$L$rhi?Y|$Llj|\|$HvSSVt$Pt$Pkdl$$dD$D$$‰T$t$Xt$Xt$ t$ Phs?/,5vZt$P$$dUh? t trtqth?뷃qwL$|1퍔$:1L$|1 u D$f G;$ ttE;l$|s1 u1 tL$VT$VX$|$ST$Y$~S5vXZT$:tT$:hwj5wp1 Ą[^_]ø hwj5wDjUWVS D$j,V2Y[t 1VRT$5YZ$u y!D$ D$RCT$:%Z$t T뻃%uFtBE1ۅD$t P[VYTD$ۉEt,CV]SXZt ,wGD$ [^_]UWVSÃ8V$,V=Y]t)$WVU u D=t5<,t1j,U ]ZthVWt$h?3u+F>,t>{ ^[^_]UW=VSUVss37tAu$t ufx3h?KXZ븋:u h?[^_]UWVSÃxT$ T$tD$t@ ŋCth?P%ZYuCD$P3^_uy 0uqD$ %=uN耟jj‰lj*yC tHu h h?YT=@u {u1{u 0tL$t=wD$pD$D$D$tbQjh@V uFP{Zu.*t #tt D$p蕆ViYD$)huD$|$ġzD$pw5wCL$ttvutt $襆$|$ t8u1ys3h@T$ | $x[^_]UWVSl] EEE߉E:-uz-u EkFWuڍE}PEPWh<@S 6@$g5E}ut E:3t EK@@vEEh_h@gLY^u@h@ghN@EtPu_ZuuuuuhT@YuhhwVS@u1MytEA1҉EEEEEEm>EE1;t1h$dPEh$d0h$d4U E@guEk@h_uQ[^Eu uhv@M1M} ]ủ]1;]u u̸uwhPSu?Eu at\MRQUZUYtRuZYMtSRQUZUYwRuuZYf_UOC 1`:h@sBY^#uS Utx>nu ~ou1VM;MZUMEuUVRq UuM <,ttj,RZYtPȋMME1҉C C7`u$s ^e>uuQh@7F _F UF 1҉Ǎe[^_]Ã|$D$tuppAZYy1SÃ`xnu jSSYZSZ1҅t Ѓ`[UWVS] h_ScZYtUh_hk@[1_u&hk@h@wuZYu eVDžXuVY%@v4>u1ۋ/Ã>ue[^_]UWVSҸ@u$duPh@ E}tC~u*}sUVZUYU[uEče[^_]Ã1<u31A_D$pD$pPT$YytN҉x8D$ptD$hD$ljT$lRV6 9މu VgZ.9tV[}t }t[^_]ÍD$PSqZY11/1S\$ hyAS ]@vZYzcu [S\$ hAS\@vZYzcu N[VS\$ j.S^Zth @P&ZYu1ۉ[^S1ۉJ م[ 1fDŽ@=uf1fDŽx @u1fDŽdBufǀǀǀǀǀǀƀƀUWVS fQT$4f\$t$|$k}.s1҉F(1 AF<[^UWVSD$1Pw551ɃDV@~9u$TD$= CC|$u";t$tL$1D$t$$l$9l$[^_]UWVSD$T$D$kD$ D$$$uD$ D$ D$$E4BD$$uL$P3T$PAt+L$E00[^_]WVShBPǫ1ǃ ǃ __8@9uQRhZY[^_'UWVġS$1$$T$ L$D$Qb]T$\$ߍl1hBSD$| Ǻ $QUD$ڈ$D$t$T$D$)D$Go1ځD$щR [^_]UWVS1l$$(L$﹀T$jdRU萤S1ɍ$D$T$T$QRS1ɍ$QRS1ɍ$QR$ D$$|$$0$󪍄$SHQR C!m $%FrCl $E+r~pXZtEFpƄ$1jdP$P蠣 $yNpKj`C%=uWD$d1Ƅ$2jdW$P= $tKj}]WIY=@u$|$wƄ$5UZD/= u Ƅ$3=`uQƄ$4s$s -1ɉ$eQRXs$s 1ɉ$}QR6 i=u Ƅ$6X=u:S0C,~RPt$hBƄ$0R P$_]t$hC1ZY|$wt%CL%=@PL$HXT$~dtB>vuDvCG%=@t$dQt$h7R[^_]UWVSӃ$=wuh'CYwGvT$D$hC$ $  u$;-u{u1ĻuyrS1ZD$ƒ<|$)Wt$ T$L$莣jS&L$T$Au~SSShCa|$t D$谹tShCt[_|$t hC葦Y11D$$$=PK=PKt PhC$޿f$$ftftPhD] t h(DS$@0$‰ø}$1$S$Z$t8$|$$1$ % $SP% PdD$(T$RD$%PL$Q$hLDס$ -SY!|$S/ottD$ PS¨YZ@uE:uxt ShpDuXZw1ɺVh;jD$0%=@ShDD$ PSNZY@u:Sh]D$0%=uctnShDؠ5dvjP$PS$E聟5dvjP$P輙u hD[Su$:ZPhIE.YXD$t|$tt$WhgE 1[^_]WVS`X@0t$芷PBSWߚY_F0t(C%=@3諝Z@u{8ctmP3+Y_@u8tThEfD$H;C F0u3hE軹XZ3F_@u8t 3hEK%=u9Ct~S Suv3PTZY@"F0s3hF=`w"= =@tW==tq==s sNjF襸W肞_Q3褔ZY@tvtqF0uk3h0FO3sY_@uSF0uMs3hCFh F̸4s$s Q3ۤ@u F0u3hGF衸XZ h]FIF0 uss3 Ct,F0@u P3Y_F0tCD$$P3XZ`[^_ɋ@Rr r蒷É@PQ(Sp<[SUXZ[UWV1SkC;Cu,hssx C jDSC v)N#sKCSAK ЉC9|)[H! [^_]WVSÃ1H%$pFuxD$$B$$B$$DPW^uK$ϗw.i$aB@~$BSK@C ʉSD$$ 9|)ыC T$$ J!ЋT$H \$T$8T$,TT$T$8T$DA\$D$\$8Z;D$8\$D߉T$8T$$\$)T$$9щT$l)ʉыT$0L$8+ =PL$L`!Lw!uf1;|$4t8T5;T$4 $d|$<d4l`Mu;L$@~1ҍD$`$`a;t$4I$d d QI;L$u$dL$<d1D`F|$(u D$L$(j09ȉuD$ L$<@t` XvYv@c3NU@U@F)EDWL${E@v!X4>NU@U@F)EDWL$PUHE@N)}D) {!)ʉU`E@_M`UH9щȉM`sЋU\)Ɖ9v)‰U\UH)9ruΉ׉EHE`NjU`uMHBAOMHU`u}Hu}\EEHEd2}\eEdMHE UM[1$XHu EfMUD$ɝ;Eth^5$1ۀz v"B0эPQ0$Q$KLkk 1ۋ4$v~v}[^_]VST$ $-T$ $ÉP(H,@0@肚C$L$؋T$ms$D$}SVKSN}D$ [^WVSP0Ëp4)9}OC$VRPS$@C )C0t C4yhFq1^ 4019s4[^_UWV1SD$T$l$ A@(@,@蜙C$D$C C4+C0S$C4PC0PR=C0$ C$C0U@EC0|$ D$ t>C0S$ C0؉ʉ $ $K0D$ t8tfC0S$@C0uߊD$ ƒu D$ ȅtD$D$ RtC09uhFDS9th)EښZG$9thF輚XtS$C0<u|u C0ws$5{S/{[^_]ËL$؋T$xR1VSË@0C"uC1҅u{ˆ[^UWVSÁ[1 /@ʊu1/uJt @ ,0t=u$EjV3n t[u[^_]VSjV3A t[u[^UWEEjPu"zM 9t h G]}UWVS0XV<@4N8D$|$ T$L$JFoF V$|$ u<$yu2~4t!\$ F这=tF41D$jhDG$)R\ thJG?1@=u@=u$O9t h\GZ$uƄ$0$$iL$tE$y$q $ō$iw2C S$ $$yCD$0<D$D$8u%|$t$t$d8C1$x$ C$%u\$($($,$,ffff$$$ $$$ $ ~C$S gC$SC$?%CT$:u:|$t3$yƄ$t$yƄ$讓$-t1)FtPhIlkYZua 7uhIS H@vXZt-;1jFWhF5u;u҉[^_WVSÃ|$uRPyxZYu>B%=t8F$-u WhH蘌4$Sol^_t 1Y[^_UWVS \$$$D$D$ThHS H@vZYtD$ 13Kj HUh H4u;uك [^_]VSËuBqurVPSQ ¸t 1[^WVSt$\$~C{ GthzHiZuHS3n3hB蹋UWVS$hH HS@vƋ$)ZYyT$uMuT$dlxm$T$Plx] t(t uu1‹$,$1Sy$9tUjX뿿[^_]ËD$T$+UWVSHEPEPPPhIu  H@vUuhHtU ɈMtzth)IՉE t hIhRI} hIhI蠉8txh!'1EPf_Z8t @ƃEt8t@ux9uMFUÍB0xU E1hIMQUfY^Eh}u hIhIEjU u4S?e>u !'E>Eu EMEuMPkZE@~5}E1u@H4ÉU*:uXE0UMPfMUXFB;t;u|щ@;Er} u/1L@9AuB;U9E;E|;u؊EEWEeZYt1ɃE1}܉]WaoUĉËUMCQEPd^X;]}}u;]u=t9uހ>u/}tu؉MeMZ5vMQYbXME^XUED9E }t@uF;us }f}܋]j eYuEgWgXZESEGEЋuG>Eet hIkXUWVS$$DŽ$P$P$P$PPhJU I=@v t$1tlJy7D8t ?+uG1 u҉$t8tfxt$D$H$$Pk]l$`U$PMa$ZY@D$`D$dD$ht&U$Pc u$hY5$T$`DŽ$N5$jt$P7iYy hJRZ t`hJP#i]Xtm GTG %G Ht!G :G %G MtG:G%GS҃ Z%Tth(JPhZYϿ?J?u w1jhWJWm uZJD$`PWh hwtmhwkĤ1[^_]Sˉщ¸yt$hJ?ZY*9uww11txx[5x5x5w5w5x5x5 x5xhJ5DvSi(U1W VST$t׺w׺!P 1$$j=W?aZYtJyuҍCuhQ:ʼn$yuL$t ;D$|$Xuw;$$9uX;$$u $ u$~0$9,$D$D$tL$tD$$t191u~ DŽ$I$$ $u D$tAtA~)~$$ taD$tuZ͍RPjg yBD$Pjm[^cD$$%=O=@D DŽ$X$$ tkjL$d$RPjMkxK $1T$܁t2$$Ӄ$$|w$$ DjRPjj% $1T$\G}(D$tF$111jT$|;$ux x'xxD$tt $1)\$$T$D$tT$ ugkD$x\$)9vT$D$t$ L$D$D$x9D$xu%$D$YD$xD$D$ +\$u$ڋD$ Zu{D$tt jrb_x\D$t xxx x;$;D$|jd^y $jd[1ۅy$jVĠ[^_]UWVSx$hJ JWu[]hJƃ]Yt)1۸JKuKR1PhK c-@v ;$|h_h@gYƅXZt<|$D$ h@g~tVdYuIVdZl$}uWhHK}D$_Xˉl$T$@D$D$$Pt$YZYtD$9~D$qD$,T$0t ]+D$4D$ l$ D$ D$|$|$<l$@ t7$dT$d$$T$UWt$ t$ DmD$ hcKt$ Sg_]t$hkKaZY~h$dhjKa_]SL$,T$4D$06PhqKfaD$4T$8+D$<T$@SL$4PhrKAaSL$u3=xu xx1ۋ$q$U >ut 0%xUWVS\$ jjJaY^¸B1D$8-uIxht@PhKT$XYZ$t#B:uߊEWt?uwv [YZ1҃u99ÉUNVS9wƉu t1D3u[^SD$ tPwxuhLáw8t hlLo;ushLQTXZ suWYr^UWVSL$ t$QYt/:-u*BR0 wN nuv& a˽ hLSVWR Ρ@v;u !')ƺLNL1$%$u`;dvuI3RySl$ XZ1҃ )T$P_MY|$t V1NZuډ8t &oKjL;u=S\$tSQRPeMQ3VX1;Y؋[!VS։t QhURYXt u ShxbRXZt1t&tҸUuT#VPR1[^1[^VS‰[^}VS‰[^eUWVS\$,hL LS/D$ @v<[^t-ph t$,$Q$.XGXD$.Rƃ|$t D$uIMJMD$ R\$ 9t$tD$M 9,$ Mu1҉!9,$t$ øHjD$@ƍD$P+Yy!T$iƍD$PZ|$~9M1(|$t9t;$tI G;|$|thMPl1D$t,$t$D$t D$1;D$t $1@ ø gUWVS$$$P$P$Ph9MW /MOá@v)ƍ<؃ |$ D$DŽ$t$$ t$0N/PۉD$y$~0.U$D$ DT$ڃT$t 1<D$$Pt$V_]xD$4%=@u f19|"؉%@1D$T$\$ ),]|$tLX|$ t(D$gPoH#S KZY\$tWE‹D$kXL$ډ!$S JZY@uShGMhSMZj |$t,t$ t$SR @uShiMhSM'j |$tD$DŽ$sM$DŽ$thsMiX$8$Ġ[^_]UWVS|$D$x$D$xyMPh{MS ǡ@v9u[t@9u3Gf4^ƉЃD$D$ D$D$|$T$1ɉCu1"e]‰WNIX|$ u>D$P3DTZYt,D$P3TZYuD$(%=t hW@|$tXt$xUhY2GcPUD$5G$y$8th$RHD$ORHUKZY|$tUKX|$ TuļU3ZYtHhD$WhH{XD$|[^_]ɁuI u MɁuIu MSw t6/@t&@tuI*u M1[UWVS1ۃ$tA18,}@u#ɋ}u?.uW҈T$t .utCF;4$|ZY[^_]WVSÃ`u wt PSNR PSR_Ztf1wpc0x X`[^_Å1EdUWVSӃ~u1u 1 u)‰Љ11ɉl$|$ $]T$D$D$ T$D$ 9T$j >D$ D$D$ ^T$ 9T$}D$1D$D$ xĘ[^_]htjRP)<W=wVSD$D$%p=uA8+B8c= uAL+BLT=0uA\+B\E=@uAT+BT6=pu3Ar%=@@Éށ)u 12JIY[t[^_UWVS҉T$L$1wt,|$u LZDph.NICD$[^D@D$}Yt D$1ywZx.uxtfx.u wtMwtDPD$tD$ 7S1ɉ‹D$ ut$ >Y@XlD$؉VAZuVC^D$1[l@;D$|1ۋ@l[uډډ}wtIډY1ɉډD$|D$~$‹D$T$1ɋD$\t$ >YD$T$xtpD$=Z$P=D$X9\$|V=^G;|$-[^_]UwW1VSt$$XNhxxxPB1ɺx1wTD$K Phxhxh9NV$zN 3N1ɃTtK`tcptctctc@tK` SAhut<$:nu w+XN觺x~j=Ztwwt %wwt% 0wwt% ww`@t %ww% `= @uc=w`uj*=]%@ w@v4>u 3~tK111w@2t hlG@>uωw1,ml@9|wttmcbF1ɉʼn9Ɖ[)ljÅ~~ډy1Ʌډ&w_[^_]UW1VSÁWơ@##su$JqЉ hNY‰$׹gZt1%$`!W/QV:ZtS?Xe[^_]UWVS\$0hNSY_ơ@v;u !'u!tjs ,jwhN Y{t hNX11D$t$D$ D$D$hW>^Zu2hOW>ZYu!|$t h+PX]WC/9^c$Ft%WPBZYu|$u-4$hO1҉C K u$11ҋ RPWSBu[^_]ÉWHUWVS$h8 pOS@vD$ $)ЋTT$Y^u'$T$h7_u4$f1(1K‹$T$hh7 tQD$uJjV6YZy j7ZuD$t)Vh{O5DvW; V3W4ZY8uT$6 3hONtXut/hOh$duh$dhOhOT FV8]yVhO-UZY'讴x xy;4$tVH5X$9[^_]1ҹ S謱:tShOWT1ZY[WVSÃ<'t<"uC$K$Ë51>tShO T^_[[^_W|$wUWVSÃ$wME܍E؊E׋EhOSU9Y_j*S1YZEH9!EUЊDtN1QC8.u$Pt .uxuhNPMXy>u uY@1[^_UWVS\$hTOSQ@vY4>[u)@1SQ4ZySh`MZYtSn+À;.Xuπ{uɃ>u[^_]ÍL$qUWVSQHqEEjPhhPV E@v<5)Ãt t+EE?E]tHmEE?EPw*E] Y^EP7*U] XZEPt*[^8u E8t >11j.Q]M5ZYPE/UYM)E9sփ?t9sljÅtKtt3E$d1Eȃ!7ɃG$SVRhmP]0U}EmMEEEr ɞu؅t G5v,ZeY[^_]aËD$@u=Pi2X1Ë 0 wj PR. u hvPNKSwwËu(I[UWVSÃL$zuzuz uzu S1R.1YD$D|$t~1D$ D$T$Yw;tGB8tA u9GPT$(Z$Bu;PT$(Y$BuGuD$ D$9D$ rT$uBf|$+xEPT$'Z$Bu|$;xO9~BPT$'Y$JuFt|8;|$~|$Ftl(;l$~l$9+})TGD$t:1D$"U+'Zu U`/YtD$0FGu؋\$3D$t*1PT$$Z$t3FGu3D$u$)$ҋFu[^_]ÍL$qUWVSQx=5wEI1}MR~}u U]M}MËNjE{tt!hPHWS2YZEPSk&URW]^&;]Eu ;} ;}IztTNWu[z]۞v#  ٞuzz~URhPS%MĉEPhPWUM%UMutkwt^E9t^)iSb,<$]W,ZE w%w5% ظ1 ؃U;t SEO'XEM;9t WE;'E_6t}u u]3E00[^t؍eY[^_]aUWVS$vl$G\$ u1;1[^_]WVSÉt PV'XZt WVZY[^_5wP=U1҉WV1SwIwPDžxDžpM Bt d?-Gh1ɋh@NdtM dDT hZQO 8udAc+8t6du Wh+;dMGtlydttl==}wPu=t%=t+>dhIMd1dM'UHt@u Wh]Q,lE Jl<؃ u hsQ(:u thQtV5w 7tjPV jj!ZYxPjj! y Qu1VjxY_u1Yw1ɸ1xVpXZM Wp l>-uF$ M tM1 tlMp-yp=tC t3tQx=tT=tZ=uclƒ1glZM1ҍEAMl1,MlUHuMzE G4ttURjj u|VjY_tU7juދPWjhw>u1 w/tD$EIdv13T54*D3uD$DS1ɅCTt'¸Sh'x88S[Åt8tRPh6:. Rh6*.XZjPWVSÃ5j D$PSW ;S>u$8t 96Y[^_UWVSP(@{Bru @HS:C<wXaÉXu9u9Tu 9u9 u 99C<w5VUJY^uu\uHD$`PU]ZulPV[^u]<u$;D$H<u$;D$H2T$d;T$D$`u";$u$$3T$X3D$\ 1[^_]UWVS"u,H @HSt>%=u:P@t0ËP@^&ZS1_@‰lj)c $>ZY[^_]UWVSÃ$ƒ0 wj D$PS l$u $\\t //t NC$C$B$s‰ŋ$EƸ y wVl$^$)[[^_]U1WVSÃ$EPGZVu+CB< tu9u hU< )T$t\_[^_]UWVSxt"VPhUK5x5xVZ)|\=xu BxxDh^WVC_]Ɗ<#u(~nuwhUVY[(HÍP8,upKSuhU-8!uK$@pŊED$u hUKL$usK&*wKT$D$)C l$HЃ w/D$8^l$ j L$QU6C |$ )PT$KZ$urgt(w;tuItC#l$tALwt$}t[pt;D$8^tU3D$8t C L$T$t$Y|$Wh0V]Zto{u{t|$ct h4V<\t< uFPEYtFCV $jVZRWhK@Y]t@{u{t hpVSsƀ{&w5CC% C!WhV=]Zt3.h^WPZY‰C|$yL$>T$ l$ D$U)<$Wl$U<$Wt$]DC1{ G|$k<@L|$ t l$|uϋD$Wtt$Y_WhV8]Zu WhVxxx>5xYx[^_]WVSljj V[Zt&1B9tH8\ttChj S"tsW%Y[^_S xáx xxB x[SShK5x Sxթu[Ëx;xVSwux@Jx@xx @[x^¸x鎩UWVwS dl$pxtND$tD$t< uP|$tDST$x]$t/SPT$r1[^$SFYx; x|1҈Ѓ [^_]WVSÃD$D$t t Vj XYVST$Z;Y$tx|$u Vjax|$tVD$ PJT$[XVT$zY$thtXZ[^_UWVS]4E EDžEEӍEEE‹5lxUAF$uTFu~u~u~t:~;E~1FMjjjWPUUą/FhxF$ ۃ ȅۈF$ta~~FFtu} ;E,~t&ҋFttjjjWPvt1ҊF$҃ ЈF$~&{V$u6uuD6u hVE~&}uE#uFthxF&=<<$]uhQ5x j WZYtxMj v xMj _[Uj WU}ZUY@ WÉU^V ҉Uu hxɉMu hV&jEhxj WPhxH @d Ux@xEE}䣠x=xu#}t=xuCUUE܋F t81;Eu/GCU]U;=x|;GU@U1;=x|N1UM<\uKUG:PЃ wmŘvtf, EBUĉMMȋUAE;w|7<&u+x BUĉMMȋUA;x|GU:kEx~ Uu';t"jhxj SủUUH}ъCMˆU=UċMȄuWM=x}[DMF$tEӍMxPYVN%uzF+FMj xfF$]FMjxFau uVN%EP=wuEӍMxPMZ}t)WMEM}EEE]S1XD}uj]^XWr[ugD$W* uDP'EEӍEEԉE}E }^5lxU&~&:uFtSPUZUYu6uShVc 8]u T]܈ u]@҈U>N1҉]Wx_u$dDt W^[Xx1tRHY)uhjW8x[E ZPWE 5x:xxEt SYE1tWZM̍}xuhj5xY[t6W5xXZ&xu=xE U]6]=wu!EӍMxP]jWS[G}u ~1e[^_]UWVSwt$xlxFt#hVP_]uh W1[<D$lD$phwD$pPD$xPh2WV )W蟁ǡ@v4D$t h]YtK膟l$p|$pu6D$liLt1|$thHh0dv18-u!xu|$udv~s_蕽u |$u N6h:WC P u5xhCWhNPD$CUtL$QPet$0T$R5xv Cx5xC ] x;x~t[^_]áxtPXËSZTL[)щáP;v z JtHáHPI9s : tBPUWVS]T$t>w )t0[t|${t|$}t))%]}( [{5Ȼ. $'L$8ρ8ρ)t$9w;Fr1҅!ZY[^_]áǀ@^áwBaÃDt HUheW_XUW)VSy݉Ӌ5y t +U D Z[^_]WVSVj.Lƃcƃb_XLPC\LY^[^_ WPLHP _UWV5SvLKFPCFL] nL@)D ~9|FL[^_]Ã`t8tRPAZYuD$,`U9WVSrB@֋=W9rL9wH9rD9s@9s )RPVq )oJ9rq9vBB[^_]W9VSË|$vӉƅ; u6x u ЍP9v򋈄Ou [^_0[^_5vPXZø]]]UWVS1ۃ~k=WW O9r$()‹W +_H__މB)PV.PT$ C T$ BY[^_]VSl[^WVS|$h]VWt$PTh]VC< [^_UWVSÃhD$L$PS-ZYxWD$%=tShXz]X;0r;pvhXXjSD$Y_y 0PShX&l$4xƋ$y,0PShXT.>9}#)9})ōT.#Sh YXZ@4$&]|$tjS[^xD$u Hh[^_]SD$ Pt$ P C<[S\$hj XZtStP[VSFssPT$aZ$t tCH9rY[^UWVSӃRY‰$+ $ōމ1 < CƊuPt$Vh)Y[^_]UWVSƄ$D$8KY}%t vuh]V.XZ1D$twhRYVfZY|$t?@$$PVA[Xt h]V0ZY? u hTYV]XV[vwGt$UD$PhVYĐ[^_]UWVSt$R,H$SUt tjt$Ua ut PP[^_]SCt QRP)QRP [WVSuhnYIhjAPT$ $x*)FRPS 19S!4[Y[^_UWVSÃ\-!ËE(9rX֋E,!9rpFPCPh]T$GRT$$u T$;}l)؃ D$T$h]ORT$fYX$9|h]GD$ PKXZ9hUD$ P6VE,ELPD$PD$P^t$OV9sT$]l\[^_]á11ҋ@(H]5vZ;5vi1”ԤYuhY S{^u0Sdt"BSduJshCdChYZ[S`~~hYD$X$ lBS`[[ËSZK9s)Rj P u[RJ9s 1Ҁ8 SáK[SCC[UWVS9ډsډÉw1=d1Ҁ8 X9wGH9v[^_]V5S1ۋFHWCV(9r[^SCC[ËS9v)Pj S. ‰؅tB[;v x PuUWVSÃT$VT$]$u0ҋxtOt8C9r/Gu,ҋ8u v)tK9s1ۉ[[^_]SCCC[UWVSÃ<.u=CG<'uD{aҋ+D$ D$|$$u!PY  Јڃ|$$u#PT$Z$  ȃ`|$$uPT$[$F|$$u P2Y!|$$u"PZ_ Ѓ[^_]Èk $fD$ZYUWVS8D$1K(k,S,{({(vC(x,v@,5D$+~(+n, lj|$(~VH9Љs< -^HU(J9vc1EHT$EHT$BE(H9r?9v6V(J9wH1D$BHET$VT$BH;l$|jHD$9tT$'T$D$J(I9L$r13M t/ u9uzu T$tT$ tw@@E9r;B8}B8J,j89r )͉AJ89u? u B8T$+C8V0lF4{Hl$0D$$\$4|$ rE81۲~ t$ D$;qF yt vu.D$twUl D$t,T$C BT$D$4@TD$ؙ|$D$H9uز Ƅl^C|$t?@lGTC9D$|29|.SlPt$8T$L$3GT)D$ L$ T$);wsATA,9T$9~ڡl)Ӊ|$ڋH,9s )ٰ r9t$ s!+D$ Pj t$( uF@D$ t$$C,sL|$(Ht1$1҉Ë|$:t $B9~$\$<$ÍD$ȉ\$*\$[\$/\$[L$L$8\$/t $H9}҉<$=8;{|t$!9v9~1҃<$t6t$@)Љ߉D$D$$5vjt$S!D$$E(H9D$$E0U4E8E|8[^_]WV5SPSfF@gSm _ tZ tUtPt V\9tuKYƄ!~' PwCƄ~1[^_UWVS 5~<t 11V=ËF;FtVFJ'DFF~ kdЙ$ǀ1$d5n,vY|$~u$d~Yu$dFDuY}|$4$t$SQRPF]PhYt$(W(9}y荌1G9r y<u ~e9Q@t`Q@s@/|$5u4F{F$$F@{ F;|$t D$:F\t<u${ CV;[[^_]?|$ uD$ T$F|tN+Uh ZZYt:u&^F1(X1|$ u?@t4hP{[]t‰ٍƉY[^_]WVSO56(F FFFHFDZ9tPcFD^y -1‹1CC[^_V5SËF9r ;vX69r[^UWVS -<:DŽ$DŽ$DŽ$Nju]NEDD$GPT$Y$u%u!DŽ$UGEJt$Q$GPT$cZ$u,u"GPL]u$GP+Yu|$ $PT$Z$u UGEuEGPYuWD$P)$!"]1Ztf$xbƋ$x Iƍ$P_u'$g B_O $$)T$Y~u$dQPRD$Ph[$,V9F~Ph-[$PU u(uxt h4[]PJ@v~PhF2$P |$t)hd[\$Sf]Zt1-$rhh[_Cu h.v^h[kCYu h.ZZh[OCXu h.>]h[3C_u h."^h[sTh[ hU0jh.S ujh[[[jh[[jh1V[jh1V j3h[RT$ $u.j=RZYWh[P4$$ PwETC< tuC; t;)|$sD$ t$ xWVZYu@D$WPr_]\@D$ $y =G‰Ë$$y$$$D$ijع[tCV7YTIT$ljÀ|$ gut$\ZÉ9rD$ËD$;$~l~PhW$P uh[#~Ph$P te~Ph[$P t?~Ph$P t|$x$ |$tD$D$=utt$h[[ډʼn)@$D$py'@P0CPt$ hXa$PUt$ h\D$;$u%WJ9u;$uGB$xt$$qtntXtQt N;$@~Wh \$WD uw$ypÉƋ=؋!bƋ4$PSh%\CChH\Y [^_]UWVS1 T$ ,N w{uL C8 uC5;u 1tj1ɉKCX+{u1h <<ЋCF =w $D$ D$ @D$ ^D$ D$D$ dC(C(pC(C@RC$PHS$~5C$PHS$~~S8S4CC111 AC@VC$PHS$~ C(%{uC@@mC$PHS$~Pr a +M Pw*xD$9;B BM 'h9{wHSJ9w@dljdhhc^lZUPp{ POJx\ D$uPhi\6j Pn_]t/PuF-pu(CSJ9uS pu_T$@F  CBljD$C>‰D$KljD$lj|${C$PHS$~CDCD$6Uh\xZYtD$uCG|$|$;{s< uD$8  CXB$HHJ$~ ;%xX PBT$HT$I9 t ;HXug C$PHS$~ ,xXe PJT$T$;Q # ;HXu P1 C$PHS$~ -wxrC` ƄllUChCd D$ T$ D$ D$8 xuCt8tpjstwD$CtXSC$PHS$~ NPJT$Pt:?uJ@@D$;C$PHS$~ nPBT$Pt:?u @HD$StjD$ BD$]t C$dBD$uCHD$StjD$ B\D$YtG\Cu\: RhUCj CjiSD$Zs +`0ux$P kP$ TЉP$@ P`*D$,( S&D$uD$ 6D$M-D$D$:CvC8 @|C$PHS$~Bt Wt@P趴_t6=ٺGj&ٺGjWGZY=ٺGj{>8 u()…)ʼnk1ɉSjCCXD[}gtD$ D$ D$ gD$5x$u@$CHCC$lC_CHCC(H9C$vC$B$HHJ$7+((@C$PS$~ J SCJ9 @CC {P~]uvCC(H9C$vC$B$HHJ$-zuCH1C CGCC(H9rCrD$x u%9J C{CC aC@xC$PHS$~1ɃXP| t!XuJP1ɋCjhC_stPNZt {t_{tsDh[HY[KCDIy&@0Ph\ S+9CC$PHS$~b|?k;+bCH9VkEPZt1҃e‰jBnC[-] RT$L$Y$L$u_ujRGZjEYYytˍT$D$nu 1Yy ЃD$Sh\辰]Zt2cu>;(v3} Et*D$l$EPmYuSh\{]Zt t$T$D$ JB12Sh]JZYt$t$T$D$ B]X11t=t9cu%= GgWJ9ЉGtdu cuh]D$PߵY[duh]Ytyuh"]D$P賵XZ|$W贴]1D$1ɀ: BωT$T$9vJŋr,$PWD$Ph']C$PHS$~ S: CCX;C;CXuCXYC$PHS$~ w=_UT$Y$u_uj UfZtj:GXHPI9sBP=_P脭]jG.uX(1ۃ-u X(=GGHS$JNC$PHS$~ ~k}WYtޯW趵Zt蜶EC|)*C;u CC;CtCC;lr;pvUPh_]t?dh{d1,l(#p0 v @$5^)…~"; u~uK^ ;HX [^_]UWVSC1C(K(C,PS,{(vC(x,v@,P,@(ǀǀB]BXB0hdB4jVh\jhhj\jtP芷t AAH1CC$CTC8sh躭ChCdC`C^^\$Fj VZYu C; t>tuӍGt]D[D$u1lމ\$T$ \$oC]ljŋCD$;Cxt(CxD$‹D$$$~^ub~hu\~X~uR~MWh$ZYt<^NB (V PF [^_]UWVS D$l$D$D$D$D$ LT$^%_ƃG~ uJu:D$PT$ D$T$D$DD$ǃu t$uxD$<uxD$"u xuD$j jxD$XÉx@u h]8;uxtC݋Cut$hS4C >C J1ɉD$C0A@hVPL$ T$ZY$L$uދD$ 0uuiu h] (u z݀)u؀zuHuω  bƍGF81Fw u/ X@  u^ X u""(1ɉڃ uq麥  `bt6cf t-df@t$pftfftlft su f{th]Sh+PNuC麷 OƊF3V F dShHu  u,麍ƊFxzF u:  1ҹ Ɖ FD$ 8:u:  1ҹ Ɖc F8tUeFIu1 JƊF.̫Q{F Vt$h]rD$D$ [^_]UwWVS$$DŽ$DŽ$wwxxx-t!t(uxtF9|u 3fVT$ljD$T$] D$u M B|$=wuyL$MD$ھ1ɉ<$T$wK|$ WD$4L$_ZL$tD$ D$$D$ T$$=wTD$9t$|<$_L$w8GWu[T$ L$%xL$_G_T$ zD$1x-xj$QhiiuG9|ρĈ[^_]VSj:VkN <+CH+[u;9-u919| ;9҉[^VSjViN Q^+CH+u Q9-u919|Q9҉[^SÃjD$PjSQ詞u<$uD$<1ZY[jPq VSL9t8uH9tH8/u1Ҁ8/Ѐ~ ҃RPvЧ [^UWVS˃ EAE)čD$ECUuE>ZuE2UK u_D$E܉u+MEuM}hVuUbUY^uuR谢EUM܉ @EXZu;s`}sy覾uPɞ_u1e[^_]jPh1胢 P褥YWVSËD$;|k;AmB%=@u. wf1u5w<Ƌt;ru;:t@9|9t0xщt=xtS+[u[^_Sø0M[WVS։=xu =xt=xtF9xt hCZ=xx5xtP5xh1d tWVh^F % = tS\X[^_U1WVS D$D$$D$l$-x1D$@]t3V5YZ DC,uC, wCyC$C$C(jPjVCP tt=xumw:xt#V`ZtjD$fyT$;w |$uxD$xH҉T$ ts x<tgD$l$)Љ$ E|$ $Ճ<t7$- x4跛 xE=xD$Xա xux$ t}@t:T$mC$SD$T$k(:<.D$ C$T$?|$ T$ jt$jWt$$nulk$k(묋T$:R<$tT$- $7=xt.T$ x4踚T$ x41@=xT$YV蕚Z<$uf=y D$;wtD$92K l$t(=xt5xh^_XUhQ[^t 5x,Y [^_]UWVSpD$h$D$lPhxhxhwD$|Phxh^V ^1 t"u T$hxu T$hx%txxx~ 踶 xw=xxt3t?T$l5:jRynY¸x=O0uuNj:fu @ u w:ettKyK@v$4)Ń=xu u]|M¸xN~xtxtx1dvC t 8-uxu C ^@tYT$RPYZuHD$%=@u8uC D$d0 jD$hPxj`|$d?xluu xhC Љ$?$ljN+M-=xu1p[^_]WVSEluux1xV还[[^_UWVS0D$$t$D|$HD$$PPD$0PD$8Ph^W. tD$$8uD$$D$ [ xD$ 1!@v<)Ɖ|$t$u^D$jYut[^UW`VSdNC$d_ 8$d_@$$d_@$d_$d_``$d`|$ $tlT$a xXD$ 8tO;t%jh,`S• uڸ,` ËT$ +;tSxZv h2`j hO`'KYL[^_]SÀ8tNj&Yt!0YPSh7jl1jjjj[UWVSÁ 8-hR`SZY$tLhi`P9S$P+p`to`$$D$ND$D$ >S1P$_]$ 8tChUɈZYuPt$V迎0SPt$hx`jc([^_]VS$1X$@tC}h4j!XZtqX[^[^1ҸWTX$ 1u~u$d=31VD$h_VF V+_3u;/Sh.j\$芃߉#t$ VjVmڸD$6.SڸSӀPTB3ӀTƸj ^ Vjj諉 ~tS)Ph[ajVS.D$3hӀj|ZY=.t1Z)j^XjjR3D$ . [^ø@hajLjj蒎h+haj2|j j jihahaj PSw8{x.hͫC 1ZtC)#u[S\$Nu gE#_ u !Ca #͸aPhajw@W1VS$t SāZuYtf1yuG1ڀt uˉ[^_V S1҉:t[^PΊX1tSu[L[PfY1tSu[$[SP;Yu Sh{b苣[SPHZu Shbh[@SPDYu ShbD[@áUW"_]UɉWV֍}SËtt*P辈Zu 8t e[^_]e؉[^_]WVSÃ<-uCPsZup&WD$PSt$ bY[^_WVSÃP'Zu$'WD$PS脅1t$ Y[^_UWVSÃ<-uCP·Yu#EWPSue[^_]UWVSÃPZu|#EWPSMuqe[^_]ú ȖtVS SNDŽZ\u[^UWVSR諄^1u WUS tSF芄Y\;u[^_]WV1SWS$YZtSFWZ\;u[^_VS։u$d/F>/tGt$dVRShb蝛[^Åt:.uJt.uzt1WV5SË>t%P5hb5Dv$1҅t"SЃZy>ShbsXY[^_UWVSuT$xRVYZy`+V7D$PSYZy8t?T$|;T$D$xu3;D$u-$;T$t$u;D$puSVhbD$D$$%=@uVhc6D$xq tVhb!|$t$D$(%=@Sh&c~jID$$ZuT$! PSzY]yt$ShEct$D$PSڊ ySh UD$D$1_ VD$Z|$~1QD$‰D$t9T$cD$‹D$yt$~t$ ~YXt$Zut$蒃Y|$D$#$PS}^ZShGMhbc `t<@TuļSVZYZFSVgt =hun=YL$xȉ $v $tCSPZYSU^_Sh}ciډ1҉ΙD$|$$%=tUhSy uI&t$D$2T$ /yt$ ['D$蹛Bu@t1VYyShczXZt$Ł$^|$t!i$%=ux0XuSP}VD| yShcܛY[LA$$S+ "ShiMhbc蚛1T= t=`t=t=u)$1$RS腇y"ShbpRVhc $$$$$PS}_ZySh9hbc $$S y$ShiMhbc踚 $S>zY^yShGMhbc蒚 1[^_]WVSہie÷u fz1Ʌtt y  t1OuAu[^_SjjjR{ y8u h襙hf~W[U1WVSÃhRST$ Mv $x9u Eu WjPZ Z[^_]øD,@@ @:UWVSà SuC ыuhG81ҖEÉ@ 0 vBEUHЃ vPT$ 'vZT$u/usW}_CC EGǀ?/u GG0 w.EEPЃ vPuYt$WD}ZCEFGǀ?"u Gu VhcG"u)蔕CŠ u ݍG\u5B  D$dL$l$L$:MuMD$L$9uB@믃 [^_]U1WVSpFt F ^1D$<%CPhdT$juYZ$u.u#C0 wS:|ZD$C0 vPhdT$%uZY$u"su|$_uCs,,h$d"d:u@98uRUCkUYtF RhdMQjE V sFt t$w7vs FRUjZUu.RoWlvsXk<wF seD<u F shd8PrjYF tcxFt t HuP7v+sXZ}u FtÜFC,S0~6M܃}gM M}=EԋUċMȋEԉS,K0}C<{4u$C,C0萋C<C@S@C@S<CS CS C,S01}}܉M{t{:tvuk9}GS t1Vs@suꋍTA)1t$8$,R(iZ(TGBG Tu̿Q~Xt @;N t8uP.N PP~t HP>u1 DžTDžPDž@DžH<0:0?Hpu0 v T4P0-u2VЃ v-u TvTh@]0=Xu!0P@:8Ot 0,Ouۃ:,0u x:u/B뉃+uXۈOt:uHBit:uJ HR-u#XۈOt:uB < B 09tBZABr ,0[?u,M-Xu*9u0628Ou $S $Ouԋ$A:tuIAt҈0Ta_X1uSiYt@F1[^_S=u11ɋ(@׃"t'uu*9u1"ffK4$tt ff|kAf|kfu1^fC6tC2&D$t ;t|u/9B|$t >a|X@fC4fu1Bf`u;W{6f`Iu TOf(fu1113Gf{4fuf(f{ttEGB1 BfS4fu13fS4f)uuf}u|$uOMB1BfS6xD$u f uB1fS4fut11@f fu&u3t/6<cu"8<duff4fu1@fC4uPC2,t&u B11 Ju@fC4f"tf't더C4f f/t11ɋ($/fJXf~tf/u؉L$  LkBA$fDkffD$y1t 6)ȋT$ [^_]1.1S(C(t5vPRTXZ (1CYAAQ [S(C(Pq\YC[ot (VSËQ9vӅt`)ډQ (A 9r()؃A w2tKu5She0][^&q)1҉@)A)މq VPhe ] [^S({,u'S,HC04YZC0us,XC,X[5(XYW=(VSG$8tX 4XG$7Cu[[^_S(tx tH 1[S(tP ;P}B @B 1[WVSP[[1ۍDu PheUZYt\CFCuډ[^_S(S$Cu rS (BS H9r@@ hU^X(@[á(P;PsS(C;Cr[(x t DrÅS~ Phf?[YX %rRh,H[Z[VS(sS9t/C$)RT0RP]KeC [)^X[^á(xt@W1V1S\$'n<$ (ۉyt>A1ҋq)AQ9sЉ"5vW^uh]jRY[Z[^_UW8VS<T$$Ps(@P$PjaUY_x $uBV5vV5dvVt$(,Tt t$XZ t$0~D$0(ۋT$0P uLtCC ($$$CCL$K$󥍻4Ƅ$Ƅ$$Ƅ$lh]jQCjWfƄ$,D$3 D$4)|$4|$(jUDŽ$4fDŽ$8X$0$ $ uu1ơ8 t҃ }9- V5 Mg tO T4 t16ttv=(C n(@"(x@A Q%|$'L$(D$(L$KS$AED$($8fD$,{,j/t$,Q_]DŽ$03|$, tP h6:PY…<:u zѿj:QT$O]ZT$t xHtGލT$oT$ʼnljnED$j:POZYtK@zt?T$DBT$ՋD$4k4T$( G($0|$$0D$(D$t$<\$@P4ʼnT$8L$4_RD$$Y2t$^QT$t$SY ~.u2D$8u)T$8/x{$dL$ڋÍD$HPS2\YZtT$HRS\YZuzL$D$89t VSTXZSS^PƉm0D0D$X%=@u |3/t /|$,tM0E,E-U0E,E0SPYt$ RZt$ aUXD$T$9T$$0t$<9Nj\$@t7DPW>P_] (A,Q0e-1ɋ(t$D$D$R,7tDD7tul$ |$$L$*zZ JP[^_]UWVSD$B$BDPV)эT1FV~8FV$v^\1ɋn~ tP8@@u;$t F|$XZ[^_]UW1VS˃ D$AiQD$MC@,$)9v$D$t$ $$C@CuD$C$D$+,$u [^_]UW1V S,$ww11D*-$t <\*E<$uAtÃ݁5?uZw[^_]Sp/BCX[UWVS4T$ Չˋl$HD$T$D$F D$ D$UT$HD$,|$ 1L$L$ T$0?FD$0t D8 uځT$tt$W3IYZNJt:Et؉%$D$$T$($T$ ZYt|$ߊ:EutG|$(tt$WsHZY$t:Et T$9$S$T$9}(Rt$v hMg_EU14[^_]St!3BSN@Y[[S҉1t ][UWVSÃ0w6jD$PST$ B $=nT$:aS:T$8<,uC.1|g8uC-|g;\" @8u܉ЉD$ -t+t=D$ u!C}g8u>-|g#4\$t$ƒtΒItICD@8u1%I@D$ug8u Xu|$t -ug 4DC;t@8uօt5u jL$y@PD$ o@T$ XYҊ $!-u! ׊<,tL$91[^_]j_^XVSptthhAP: x[PSIZ1YuD$1%=…҈-t&H9t$byT )H{]SCXp[^UWVS:xt $1 B$1*0 v W;4$r <$u!Iu:J,$w ABvug8uBA9uA Z[^_]WVSQhg\$ S7] ~ ~wF NHut$,hgWVE[^_WVSjP39ZYxhWP/Zu1P1҃ 詸¡8uˋ|$1S$|$0RhgUB6 |$4t($<PUFY_u$TC4$XC8|$8t5(hgV|$D>4YZ?j)W%:YZD$ j(W8_ZPD$,6$P$Pt$0$Pt$4t$4$Pt$8t$8t$8t$8hgD$<PsB4 $K C$S$S<$ʁ  ʅS@u {DZtCEWCE $yCF<҃NCFD$t%h hV=s :$ C D$tjs9ChgVt$Hp=$ ~7D$tHfCȉ $lVC $fCVC[^_]UWV1SËp98u=B9|FC<0չ ‹S3F[^_]ɹ0w¹*0w{UWVS Eܡ2BEu‹EܹX˅WNUtEV@Pu&? }MfEEhM19P2EYUEJX: t\ESFMEL؉Mԉу9Mu@8yEyE1\]CfU:XEӍeډ[^_]øUWVSxɉT$$u|$u DŽ$|҃T$uT$RVT$[Z$y3D$@:8,RVT$BZY$D$(%=@tW$D$uW$$D$D$ u'W$$VK7D$ [GD$|$@P2t0t$$$T$W!=6Yt$8Zu|$t$;X|$ t)T$W$$u1D$ uUx[^_] UWVSÃdD$PSZA^]y#8t Sh U)D$%=@uShUhTujS5ZYy j6]ut'S5hhh5Dvh:4S5D$^1%PijtyU4Y4$17Zu4$9]yShc=t'S5hh5Dv9觯S:YyyShO/TXZgu*jS4^]yD$%=t j5Yut#S5hh5Dv`9,t S7Zx1d[^_]ÁD$P3g`Z|$CtD$CAPĈS1Ɋ Au[ÅStYDSRP1 [ËD$.UW1VStUW!/XZGu[^_]VSĀS.VS9jSj8Ę[^SjP/Sv7j2VSĀS:jSV8Đ[^jRP3 W#VSÁ1؉$Č[^_W#VSÁ1؉$DŽ$Č[^_U#WVSÁ11$t!ÉZGuČ[^_]VS8/u@/t>.u4JZɈL$t+/t&.uJɈL$t/u 9vH8/u@Ӏ{Su9t8/t@Z[^VS8/u iN1 AS1Y_[^SCtP{.Zt[SCPc.Yu[1 l9unfy%Bu1WVS14l9t Cu[^_VSÃ$7$ҋCuZ[^Pjh J- t hh9PÃ$ZYUWVSEUЙ@BÉƋE։؃[^_]SR2Zu ShO[UWVSÃD$j:PU/Y_D$ D$PnU~WhhS7HD$PUWV RNQhhST$L$ 7$L$aFD$D$PUWRQt$hhST$ L$$7 $L$$D$PUWRQt$hhSf7 nlN|$:gD$PVhhD$Aj.SI8]Z)؃u$D$PFPhiS 7%uD$PFPFPhiS6H'u-D$PFPFPF PhiS6u(D$PFPFPF PFPhhS6/ u.D$PFPFPF PFPFPhhSQ6 ~r8 ukD$PFPFPF PFPFPh iS6 ~?nlN|$.u'j.S+Y_T$RVhh@P5HuD$|$t ShlM[^_]Sí;tS5Xu[ÃwktDW1V S蛪:t;jhiS4 u1WS2ZYu F u[^_UWVS \$ $v,$<$u 1D$J1<$L$tz l$ 3,+2L5?l$H,L5H ;H<$ $S@HAu [^_]3y h4LVSt GFtj1j1j1 jh(YƅXy1ҸGH VG.Zƃvu@tj5*jV--jV%-jV-V1Xt N[^øEUW=VSUVS / u?t[^_]Ã~,1ɉ@t $ƃtQ1~ Zɹ$D$,|8u 4$D$0 .D$ jo**T$tT$YZ\t heiiJXúNG_vGh_Ph)ZYVSRPZ)ƅXZuJ[^=It8-uxt1F1=Idvt8-uxt _tX?VSFESi/X[^UWVSà L$l$$<+<-P'_=VD$ PST$ , ?$ut;\$tnu%*t$Uk3ZYu19r0}u֋D$8u3;t$ w;t$r [^_]D$ 1R1PD$ RPSh|iHShiHR1ɺ j1jQѺ ù1ù1t$QѺ j1jUWVSÍ} UWwEUGW E؊U<+<-P%_=EuMPS( MԉEU?;]uGLuV2ZYu31WVjj7;Urbw;Er[MEʉEU~uE8uKU9Uw,rE9Ew"U9UrwE9ErEUe[^_]uuuuSh|iRGShiGGUWR jjjj}fxufPWVSRj$Vh\$SjPT.1ut DVShiA Đ[^_úUWVS0j:PUĉME.&_Zt\)HA)čD$@1ҹ EȍCݣ=w Eġ8tVhi*F[1E^ZuȍU1׹EEEEЍEPRju#(u}uV1hiEEZYt5=;G,CËGCwOljUfpu"Xe[^_]ùUWVSÃۉtE51ҹ $̢=w>tWSu/[_‰t Bf$Y[^_]SQRP y(f;usc!Phjh#cEhjYE[V1S@> S[^jhHjjP,jhHjjP|,WVSӃ$t$Z=j VjjWV,tSh"jD$D[^$$[^_W=VSÃ@؉tAVP+ZYu?"tS$h=jND1Y[[^_SV'ZP[^_4ASP-Zu ShU[WV1S1ۃP؉AVPW* u S1>$X9}[^_VSu'DjtRWZPVhRjJC [^UWVSt@olutbt] MuP#^S1#YF8/t,P`&Z<8؉?@8VP%'V# Sr#^S+&Yx녉[^_]UWVSÍFu'׉T.?Nύ,(É1[^_]UWV1SQRP# t jjSP'?UPSW' [^_]St PShkj B[hؑjRPpËD$T$D$T$,S%\$ 0r"ډD$ $DB7UWVSÃj:RMUZUYƉtF)эA)č|$d}t51ҹ ¡8uRU%U_tP SW>+YtKP@ Ct9}t1ҹ 襞:tVZt @C1e[^_]Su Sh~j@[VSj.RZYuj:SZYt:0艜(9u@~0vFxuډ[^[^Ë$US[h -Y[[[6E}}E!F_FrGGHfBB<HI5MePBTW^YZs[c,ds's@"2d!f*g((*ujvz6||ε}NCC+"+5"Dh "VPbEEg6 [^aǭʯͯ  O,Ws@T]ftz$BIMX`3hSrS~  AA"C    ! !!! !*!8dЗ4!C!J!vQ!V!e!k!$At!x!C!J!v!! v#-#-####-#-##-#-##$$,$<$P$b$w$  ' 1!!1!!!   3(!)1*!,23568<=BCM y9K/`%" $ T0  @DC0000000000000011$1$1$1$1$1$1$1$1)1)1115555555555555555555555 6 666,6r\f[[[[N[[_[[D[ \8\\f[c\\U[\0[\]\\]:[:[[}f>/#Ppp~~~șwҙ? (<>     8'8/8:8G8P8X8_8g8p8{888/:}-+?=%%%###:///83:<:I:O:R:U:Y:]:`:888c:f:888888l:q:u:8y:::888/87878 ^8a8Dž88889Dž 9j99M9}%9/,9a09+69<9~B9G9KN97V9{[9)a9}k9Ls9ׂx9>M9979F?9;9/9W9Y99c|9|9t f d s c m lpn v wtime(seconds)file(blocks)data(kb)stack(kb)coredump(blocks)memory(kb)locked memory(kb)processnofilesvmemory(kb)locks9:/ : @ 9 9 9~ 7= ==>#>A>bkmloopdefaultsnoautoswswap_netdevnosuidsuiddevnodevexecnoexecsyncdirsyncasyncatimenoatimediratimenodiratimemandnomandrelatimenorelatimeloudbindmovesharedslaveprivateunbindablersharedrslaverprivaterunbindablerorwremount @@@  @@@@ /etc/filesystems/proc/filesystems0000000000000000000000000000000000000000000.zip.ZIPHHcwbkDkKMD@BMGDʚ;G@ @` 0@!`P`  `bkBevenpparityoddpnleksanecookedrawpass8litoutcbreakcrtdecdecctlqtabslcaseLCASEparenbparoddcs5cs6cs7cs8hupclhupcstopbcreadclocalcrtsctsignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonixofftandemiuclcixanyimaxbelopostolcucocrnlonlcronocronlretofillofdelnl1nl0cr3cr2cr1cr0tab3tab2tab1tab0bs1bs0vt1vt0ff1ff0isigicanoniextenechoechoecrteraseechokechonlnoflshxcasetostopechoprtprteraseechoctlctlechoechokecrtkill             000 00 @ @   @  @@@  @         intrquiterasekilleofeoleol2swtchstartstopsusprprntweraselnextflushmintimebkm     !"#$%&A i[',6?WQGL (?`E} +BLT`} Eb?e(IIIIIIIIIIr`ww`Vw-eW`}E-YV-+Y-JS`cCdDJoOpPrRxX<>~cwbk#!CgE#;e2!'xjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ?pc?d?b?-?l?s???rwxSTst$II  82Kn,X   `  %KEXITHUPINTQUITILLTRAPABRTBUSFPEKILLUSR1SEGVUSR2PIPEALRMTERMSTKFLTCHLDCONTSTOPTSTPTTINTTOUURGXCPUXFSZVTALRMPROFWINCHPOLLPWRSYS  $*06=BHLOSX[ehpv %*06=DIORY_dox !',29@CFKQX^b @@  #+3;CScs !1Aa  0@`?? multi-call binary No help available. Usage: --helpbusybox multi-call binary Copyright (C) 1998-2008 Erik Andersen, Rob Landley, Denys Vlasenko and others. Licensed under GPLv2. See source distribution for full notice. Usage: busybox [function] [arguments]... or: function [arguments]... BusyBox is a multi-call binary that combines many common Unix utilities into a single executable. Most people will create a link to busybox for each function they wish to use and BusyBox will act like whatever it was invoked as! Currently defined functions: , : applet not found [[[ashbasenamebunzip2bzcatcatchgrpchmodchownchrootchvtclearcmpcpcutdatedddeallocvtdfdirnamedmesgdnsdomainnameduechoegrepenvexprfalsefgrepfindfreegrepgunzipgziphaltheadhexdumphostnameidifconfiginitinstallkillkillallklogdlinuxrclnloggerlsmd5summdevmkdirmknodmkswapmktempmoremountmvopenvtpidofpingpivot_rootpoweroffprintfpspwdreadlinkrebootresetrmrmdirroutesedseqshsleepsortstringssttyswapoffswaponsyncsyslogdtailtarteetesttimetouchtrtruettyudhcpcumountunameuniqunzipuptimeusleepviwcwgetwhichwhoamixargsyeszcatEXPRESSION ] Check file types, compare values etc. Return a 0/1 exit code depending on logical value of EXPRESSIONEXPRESSION ] Check file types, compare values etc. Return a 0/1 exit code depending on logical value of EXPRESSIONFILE [SUFFIX] Strip directory path and suffixes from FILE. If specified, also remove any trailing SUFFIX.[OPTIONS] [FILE] Uncompress FILE (or standard input if FILE is '-' or omitted) Options: -c Write to standard output -f ForceFILE Uncompress to stdout[-u] [FILE]... Concatenate FILE(s) and print them to stdout Options: -u Use unbuffered i/o (ignored)[-RhLHP]... GROUP FILE... Change the group membership of each FILE to GROUP Options: -R Recurse directories -h Affect symlinks instead of symlink targets -L Traverse all symlinks to directories -H Traverse symlinks on command line only -P Do not traverse symlinks (default)[-R] MODE[,MODE]... FILE... Each MODE is one or more of the letters ugoa, one of the symbols +-= and one or more of the letters rwxst Options: -R Recurse directories[-RhLHP]... OWNER[<.|:>[GROUP]] FILE... Change the owner and/or group of each FILE to OWNER and/or GROUP Options: -R Recurse directories -h Affect symlinks instead of symlink targets -L Traverse all symlinks to directories -H Traverse symlinks on command line only -P Do not traverse symlinks (default)NEWROOT [PROG [ARGS]] Run PROG with root directory set to NEWROOTN Change the foreground virtual terminal to /dev/ttyN Clear screen[-l] [-s] FILE1 [FILE2]] Compares FILE1 vs stdin if FILE2 is not specified Options: -l Write the byte numbers (decimal) and values (octal) for all differing bytes -s Quiet[OPTIONS] SOURCE DEST Copy SOURCE to DEST, or multiple SOURCE(s) to DIRECTORY Options: -a Same as -dpR -d,-P Preserve links -H,-L Dereference all symlinks (default) -p Preserve file attributes if possible -f Force overwrite -i Prompt before overwrite -R,-r Recurse directories -l,-s Create (sym)links[OPTIONS] [FILE]... Print selected fields from each input FILE to standard output Options: -b LIST Output only bytes from LIST -c LIST Output only characters from LIST -d CHAR Use CHAR instead of tab as the field delimiter -s Output only the lines containing delimiter -f N Print only these fields -n Ignored[OPTIONS] [+FMT] [TIME] Display time (using +FMT), or set time Options: [-s] TIME Set time to TIME -u Work in UTC (don't convert to local time) -R Output RFC-822 compliant date string -I[SPEC] Output ISO-8601 compliant date string SPEC='date' (default) for date only, 'hours', 'minutes', or 'seconds' for date and time to the indicated precision -r FILE Display last modification time of FILE -d TIME Display TIME, not 'now' -D FMT Use FMT for -d TIME conversion Recognized formats for TIME: hh:mm[:ss] [YYYY.]MM.DD-hh:mm[:ss] YYYY-MM-DD hh:mm[:ss] [[[[[YY]YY]MM]DD]hh]mm[.ss][if=FILE] [of=FILE] [bs=N] [count=N] [skip=N] [seek=N] Copy a file with converting and formatting Options: if=FILE Read from FILE instead of stdin of=FILE Write to FILE instead of stdout bs=N Read and write N bytes at a time count=N Copy only N input blocks skip=N Skip N input blocks seek=N Skip N output blocks Numbers may be suffixed by c (x1), w (x2), b (x512), kD (x1000), k (x1024), MD (x1000000), M (x1048576), GD (x1000000000) or G (x1073741824)[N] Deallocate unused virtual terminal /dev/ttyN[-Pkmh] [FILESYSTEM...] Print filesystem usage statistics Options: -P POSIX output format -k 1024-byte blocks (default) -m 1M-byte blocks -h Human readable (e.g. 1K 243M 2G)FILENAME Strip non-directory suffix from FILENAME[-c] [-n LEVEL] [-s SIZE] Print or control the kernel ring buffer Options: -c Clear ring buffer after printing -n LEVEL Set console logging level -s SIZE Buffer size[-aHLdclsxhmk] [FILE]... Summarize disk space used for each FILE and/or directory. Disk space is printed in units of 1024 bytes. Options: -a Show file sizes too -H Follow symlinks on command line -L Follow all symlinks -d N Limit output to directories (and files with -a) of depth < N -c Show grand total -l Count sizes many times if hard linked -s Display only a total for each argument -x Skip directories on different filesystems -h Sizes in human readable format (e.g., 1K 243M 2G ) -m Sizes in megabytes -k Sizes in kilobytes (default)[-neE] [ARG...] Print the specified ARGs to stdout Options: -n Suppress trailing newline -e Interpret backslash-escaped characters (i.e., \t=tab) -E Disable interpretation of backslash-escaped characters[-iu] [-] [name=value]... [PROG [ARGS]] Print the current environment or run PROG after setting up the specified environment Options: -, -i Start with an empty environment -u Remove variable from the environmentEXPRESSION Print the value of EXPRESSION to standard output. EXPRESSION may be: ARG1 | ARG2 ARG1 if it is neither null nor 0, otherwise ARG2 ARG1 & ARG2 ARG1 if neither argument is null or 0, otherwise 0 ARG1 < ARG2 1 if ARG1 is less than ARG2, else 0. Similarly: ARG1 <= ARG2 ARG1 = ARG2 ARG1 != ARG2 ARG1 >= ARG2 ARG1 > ARG2 ARG1 + ARG2 Sum of ARG1 and ARG2. Similarly: ARG1 - ARG2 ARG1 * ARG2 ARG1 / ARG2 ARG1 % ARG2 STRING : REGEXP Anchored pattern match of REGEXP in STRING match STRING REGEXP Same as STRING : REGEXP substr STRING POS LENGTH Substring of STRING, POS counted from 1 index STRING CHARS Index in STRING where any CHARS is found, or 0 length STRING Length of STRING quote TOKEN Interpret TOKEN as a string, even if it is a keyword like 'match' or an operator like '/' (EXPRESSION) Value of EXPRESSION Beware that many operators need to be escaped or quoted for shells. Comparisons are arithmetic if both ARGs are numbers, else lexicographical. Pattern matches return the string matched between \( and \) or null; if \( and \) are not used, they return the number of characters matched or 0. Return an exit code of FALSE (1)[PATH...] [EXPRESSION] Search for files. The default PATH is the current directory, default EXPRESSION is '-print' EXPRESSION may consist of: -follow Dereference symlinks -xdev Don't descend directories on other filesystems -maxdepth N Descend at most N levels. -maxdepth 0 applies tests/actions to command line arguments only -mindepth N Do not act on first N levels -name PATTERN File name (w/o directory name) matches PATTERN -iname PATTERN Case insensitive -name -path PATTERN Path matches PATTERN -regex PATTERN Path matches regex PATTERN -type X File type is X (X is one of: f,d,l,b,c,...) -perm NNN Permissions match any of (+NNN), all of (-NNN), or exactly (NNN) -mtime DAYS Modified time is greater than (+N), less than (-N), or exactly (N) days -mmin MINS Modified time is greater than (+N), less than (-N), or exactly (N) minutes -user NAME File is owned by user NAME (numeric user ID allowed) -group NAME File belongs to group NAME (numeric group ID allowed) -depth Process directory name after traversing it -size N[bck] File size is N (c:bytes,k:kbytes,b:512 bytes(def.)). +/-N: file size is bigger/smaller than N -print Print (default and assumed) -print0 Delimit output with null characters rather than newlines -exec CMD ARG ; Run CMD with all instances of {} replaced by the matching files -prune Stop traversing current subtree (EXPR) Group an expression Display the amount of free and used system memory[-HhrilLnqvsoeFEABC] PATTERN [FILE]... Search for PATTERN in each FILE or standard input Options: -H Prefix output lines with filename where match was found -h Suppress the prefixing filename on output -r Recurse subdirectories -i Ignore case distinctions -l List names of files that match -L List names of files that do not match -n Print line number with output lines -q Quiet. Return 0 if PATTERN is found, 1 otherwise -v Select non-matching lines -s Suppress file open/read error messages -c Only print count of matching lines -o Show only the part of a line that matches PATTERN -m MAX Match up to MAX times per file -F PATTERN is a set of newline-separated strings -E PATTERN is an extended regular expression -e PTRN Pattern to match -f FILE Read pattern from file -A Print NUM lines of trailing context -B Print NUM lines of leading context -C Print NUM lines of output context[OPTIONS] [FILE]... Uncompress FILEs (or standard input) Options: -c Write to standard output -f Force -t Test file integrity[OPTIONS] [FILE]... Compress FILEs (or standard input) Options: -c Write to standard output -d Decompress -f Force[-d delay] [-n] [-f] Halt the system Options: -d Delay interval for halting -n No call to sync() -f Force halt (don't go through init)[OPTIONS] [FILE]... Print first 10 lines of each FILE to standard output. With more than one FILE, precede each with a header giving the file name. With no FILE, or when FILE is -, read standard input. Options: -n NUM Print first NUM lines instead of first 10[-bcCdefnosvx] FILE... Display file(s) or standard input in a user specified format Options: -b One-byte octal display -c One-byte character display -C Canonical hex+ASCII, 16 bytes per line -d Two-byte decimal display -e FORMAT STRING -f FORMAT FILE -n LENGTH Interpret only LENGTH bytes of input -o Two-byte octal display -s OFFSET Skip OFFSET bytes -v Display all input data -x Two-byte hexadecimal display[OPTIONS] [HOSTNAME | -F FILE] Get or set hostname or DNS domain name Options: -s Short -i Addresses for the hostname -d DNS domain name -f Fully qualified domain name -F FILE Use FILE's content as hostname[OPTIONS] [USER] Print information about USER or the current user Options: -u Print user ID -g Print group ID -G Print supplementary group IDs -n Print name instead of a number -r Print real user ID instead of effective ID[-a] interface [address] Configure a network interface Options: [[-]broadcast [ADDRESS]] [[-]pointopoint [ADDRESS]] [netmask ADDRESS] [dstaddr ADDRESS] [metric NN] [mtu NN] [[-]trailers] [[-]arp] [[-]allmulti] [multicast] [[-]promisc] [txqueuelen NN] [[-]dynamic] [up|down] ... Init is the parent of all processes[-cdDsp] [-o USER] [-g GRP] [-m MODE] [source] dest|directory Copy files and set attributes Options: -c Just copy (default) -d Create directories -D Create leading target directories -s Strip symbol table -p Preserve date -o USER Set ownership -g GRP Set group ownership -m MODE Set permissions[-l] [-SIG] PID... Send a signal (default is TERM) to given PIDs Options: -l List all signal names and numbers[-l] [-q] [-SIG] process-name... Send a signal (default is TERM) to given processes Options: -l List all signal names and numbers -q Do not complain if no processes were killed[-c N] [-n] Kernel logger Options: -c N Only messages with level < N are printed to console -n Run in foreground[OPTIONS] TARGET... LINK_NAME|DIRECTORY Create a link named LINK_NAME or DIRECTORY to the specified TARGET. Use '--' to indicate that all following arguments are non-options. Options: -s Make symlinks instead of hardlinks -f Remove existing destination files -n Don't dereference symlinks - treat like normal file -b Make a backup of the target (if exists) before link operation -S suf Use suffix instead of ~ when making backup files[OPTIONS] [MESSAGE] Write MESSAGE to the system log. If MESSAGE is omitted, log stdin. Options: -s Log to stderr as well as the system log -t TAG Log using the specified tag (defaults to user name) -p PRIO Priority (numeric or facility.level pair)[-1AacCdeFilnpLRrSsTtuvwxXhk] [FILE]... List directory contents Options: -1 List in a single column -A Don't list . and .. -a Don't hide entries starting with . -C List by columns -c With -l: sort by ctime --color[={always,never,auto}] Control coloring -d List directory entries instead of contents -e List full date and time -F Append indicator (one of */=@|) to entries -i List inode numbers -l Long listing format -n List numeric UIDs and GIDs instead of names -p Append indicator (one of /=@|) to entries -L List entries pointed to by symlinks -R List subdirectories recursively -r Sort in reverse order -S Sort by file size -s List the size of each file, in blocks -T NUM Assume tabstop every NUM columns -t With -l: sort by modification time -u With -l: sort by access time -v Sort by version -w NUM Assume the terminal is NUM columns wide -x List by lines -X Sort by extension -h List sizes in human readable format (1K 243M 2G)[OPTIONS] [FILE]... or: md5sum [OPTIONS] -c [FILE] Print or check MD5 checksums Options: -c Check sums against given list -s Don't output anything, status code shows success -w Warn about improperly formatted checksum lines[-s] -s Scan /sys and populate /dev during system boot It can be run by kernel as a hotplug helper. To activate it: echo /bin/mdev >/proc/sys/kernel/hotplug [OPTIONS] DIRECTORY... Create DIRECTORY Options: -m Set permission mode (as in chmod), not rwxrwxrwx - umask -p No error if existing, make parent directories as needed[OPTIONS] NAME TYPE MAJOR MINOR Create a special file (block, character, or pipe) Options: -m Create the special file using the specified mode (default a=rw) TYPEs include: b: Make a block device c or u: Make a character device p: Make a named pipe (MAJOR and MINOR are ignored)DEVICE Prepare block device to be used as swap partition[-dt] [-p DIR] [TEMPLATE] Create a temporary file with name based on TEMPLATE and print its name. TEMPLATE must end with XXXXXX (e.g. [/dir/]nameXXXXXX). Options: -d Make a directory instead of a file -t Generate a path rooted in temporary directory -p DIR Use DIR as a temporary directory (implies -t) For -t or -p, directory is chosen as follows: $TMPDIR if set, else -p DIR, else /tmp[FILE]... View FILE or standard input one screenful at a time[flags] DEVICE NODE [-o OPT,OPT] Mount a filesystem. Filesystem autodetection requires /proc be mounted. Options: -a Mount all filesystems in fstab -r Read-only mount -w Read-write mount (default) -t FSTYPE Filesystem type -O OPT Mount only filesystems with option OPT (-a only) -o OPT: loop Ignored (loop devices are autodetected) [a]sync Writes are [a]synchronous [no]atime Disable/enable updates to inode access times [no]diratime Disable/enable atime updates to directories [no]relatime Disable/enable atime updates relative to modification time [no]dev (Dis)allow use of special device files [no]exec (Dis)allow use of executable files [no]suid (Dis)allow set-user-id-root programs [r]shared Convert [recursively] to a shared subtree [r]slave Convert [recursively] to a slave subtree [r]private Convert [recursively] to a private subtree [un]bindable Make mount point [un]able to be bind mounted bind Bind a directory to an additional location move Relocate an existing mount point remount Remount a mounted filesystem, changing its flags ro/rw Read-only/read-write mount There are EVEN MORE flags that are specific to each filesystem You'll have to see the written documentation for those filesystems[OPTIONS] SOURCE DEST or: mv [OPTIONS] SOURCE... DIRECTORY Rename SOURCE to DEST, or move SOURCE(s) to DIRECTORY Options: -f Don't prompt before overwriting -i Interactive, prompt before overwrite[-c N] [-sw] [PROG [ARGS]] Start PROG on a new virtual terminal Options: -c N Use specified VT -s Switch to the VT -w Wait for PROG to exit[NAME...] List PIDs of all processes with names that match NAMEs[OPTIONS] HOST Send ICMP ECHO_REQUEST packets to network hosts Options: -4, -6 Force IPv4 or IPv6 hostname resolution -c CNT Send only CNT pings -s SIZE Send SIZE data bytes in packets (default:56) -I IFACE/IP Use interface or IP address as source -W SEC Seconds to wait for the first response (default:10) (after all -c CNT packets are sent) -w SEC Seconds until ping exits (default:infinite) (can exit earlier with -c CNT) -q Quiet, only displays output at start and when finishedNEW_ROOT PUT_OLD Move the current root file system to PUT_OLD and make NEW_ROOT the new root file system[-d delay] [-n] [-f] Halt and shut off power Options: -d Delay interval for halting -n No call to sync() -f Force power off (don't go through init)FORMAT [ARGUMENT...] Format and print ARGUMENT(s) according to FORMAT, where FORMAT controls the output exactly as in C printf Report process status This version of ps accepts no options Print the full filename of the current working directoryFILE Display the value of a symlink[-d delay] [-n] [-f] Reboot the system Options: -d Delay interval for rebooting -n No call to sync() -f Force reboot (don't go through init) Reset the screen[OPTIONS] FILE... Remove (unlink) the FILE(s). Use '--' to indicate that all following arguments are non-options. Options: -i Always prompt before removing -f Never prompt -r,-R Remove directories recursively[OPTIONS] DIRECTORY... Remove the DIRECTORY, if it is empty. Options: -p Include parents[{add|del|delete}] Edit kernel routing tables Options: -n Don't resolve names -e Display other/more information -A inet Select address family[-efinr] SED_CMD [FILE]... Options: -e CMD Add CMD to sed commands to be executed -f FILE Add FILE contents to sed commands to be executed -i Edit files in-place -n Suppress automatic printing of pattern space -r Use extended regex syntax If no -e or -f is given, the first non-option argument is taken as the sed command to interpret. All remaining arguments are names of input files; if no input files are specified, then the standard input is read. Source files will not be modified unless -i option is given.[-w] [-s SEP] [FIRST [INC]] LAST Print numbers from FIRST to LAST, in steps of INC. FIRST, INC default to 1 Options: -w Pad to last with leading zeros -s SEP String separatorN Pause for N seconds[-nrugMcszbdfimSTokt] [-o FILE] [-k start[.offset][opts][,end[.offset][opts]] [-t CHAR] [FILE]... Sort lines of text Options: -b Ignore leading blanks -c Check whether input is sorted -d Dictionary order (blank or alphanumeric only) -f Ignore case -g General numerical sort -i Ignore unprintable characters -k Sort key -M Sort month -n Sort numbers -o Output to file -k Sort by key -t CHAR Key separator -r Reverse sort order -s Stable (don't sort ties alphabetically) -u Suppress duplicate lines -z Lines are terminated by NUL, not newline -mST Ignored for GNU compatibility[-afo] [-n LEN] [FILE]... Display printable strings in a binary file Options: -a Scan whole file (default) -f Precede strings with filenames -n LEN At least LEN characters form a string (default 4) -o Precede strings with decimal offsets[-a|g] [-F DEVICE] [SETTING]... Without arguments, prints baud rate, line discipline, and deviations from stty sane Options: -F DEVICE Open device instead of stdin -a Print all current settings in human-readable form -g Print in stty-readable form [SETTING] See manpage[-a] [DEVICE] Stop swapping on DEVICE Options: -a Stop swapping on all swap devices[-a] [DEVICE] Start swapping on DEVICE Options: -a Start swapping on all swap devices Write all buffered blocks to disk[OPTIONS] System logging utility. Note that this version of syslogd ignores /etc/syslog.conf. Options: -n Run in foreground -O FILE Log to given file (default:/var/log/messages) -l n Set local log level -S Smaller logging output -s SIZE Max size (KB) before rotate (default:200KB, 0=off) -b NUM Number of rotated logs to keep (default:1, max=99, 0=purge)[OPTIONS] [FILE]... Print last 10 lines of each FILE to standard output. With more than one FILE, precede each with a header giving the file name. With no FILE, or when FILE is -, read standard input. Options: -n N[kbm] Print last N lines instead of last 10 -f Output data as the file grows-[czjxtvO] [-f TARFILE] [-C DIR] [FILE(s)]... Create, extract, or list files from a tar file Options: c Create x Extract t List Archive format selection: z Filter the archive through gzip j Filter the archive through bzip2 File selection: f Name of TARFILE or "-" for stdin O Extract to stdout C Change to directory DIR before operation v Verbose[OPTIONS] [FILE]... Copy standard input to each FILE, and also to standard output Options: -a Append to the given FILEs, do not overwrite -i Ignore interrupt signals (SIGINT)EXPRESSION ] Check file types, compare values etc. Return a 0/1 exit code depending on logical value of EXPRESSION[OPTIONS] PROG [ARGS] Run PROG. When it finishes, its resource usage is displayed. Options: -v Verbose[-c] [-d DATE] FILE [FILE]... Update the last-modified date on the given FILE[s] Options: -c Do not create files -d DT Date/time to use[-cds] STRING1 [STRING2] Translate, squeeze, and/or delete characters from standard input, writing to standard output Options: -c Take complement of STRING1 -d Delete input characters coded STRING1 -s Squeeze multiple output characters of STRING2 into one character Return an exit code of TRUE (0) Print file name of standard input's terminal Options: -s Print nothing, only return exit status[-Cfbnqtvo] [-c CID] [-V VCLS] [-H HOSTNAME] [-i INTERFACE] [-p pidfile] [-r IP] [-s script] [-O dhcp-option]... -V,--vendorclass=CLASSID Vendor class identifier -i,--interface=INTERFACE Interface to use (default eth0) -H,-h,--hostname=HOSTNAME Client hostname -c,--clientid=CLIENTID Client identifier -C,--clientid-none Suppress default client identifier -p,--pidfile=file Create pidfile -r,--request=IP IP address to request -s,--script=file Run file at DHCP events (default /usr/share/udhcpc/default.script) -t,--retries=N Send up to N request packets -T,--timeout=N Try to get a lease for N seconds (default 3) -A,--tryagain=N Wait N seconds (default 20) after failure -O,--request-option=OPT Request DHCP option OPT (cumulative) -o,--no-default-options Do not request any options (unless -O is also given) -f,--foreground Run in foreground -b,--background Background if lease is not immediately obtained -S,--syslog Log to syslog too -n,--now Exit with failure if lease is not immediately obtained -q,--quit Quit after obtaining lease -R,--release Release IP on quit -a,--arping Use arping to validate offered address[flags] FILESYSTEM|DIRECTORY Unmount file systems Options: -a Unmount all file systems -r Try to remount devices as read-only if mount is busy -l Lazy umount (detach filesystem) -f Force umount (i.e., unreachable NFS server) -d Free loop device if it has been used[-amnrspv] Print system information. Options: -a Print all -m The machine (hardware) type -n Hostname -r OS release -s OS name (default) -p Processor type -v OS version[-fscduw]... [INPUT [OUTPUT]] Discard duplicate lines Options: -c Prefix lines by the number of occurrences -d Only print duplicate lines -u Only print unique lines -f N Skip first N fields -s N Skip first N chars (after any skipped fields) -w N Compare N characters in line[-opts[modifiers]] file[.zip] [list] [-x xlist] [-d exdir] Extract files from ZIP archives Options: -l List archive contents (with -q for short form) -n Never overwrite existing files (default) -o Overwrite files without prompting -p Send output to stdout -q Quiet -x Exclude these files -d Extract files into this directory Display the time since the last bootN Pause for N microseconds[OPTIONS] [FILE]... Edit FILE Options: -c Initial command to run ($EXINIT also available) -R Read-only - do not write to the file -H Short help regarding available features[OPTIONS] [FILE]... Print line, word, and byte counts for each FILE, and a total line if more than one FILE is specified. With no FILE, read standard input. Options: -c Print the byte counts -l Print the newline counts -L Print the length of the longest line -w Print the word counts[-csq] [-O file] [-Y on/off] [-P DIR] [-U agent] url Retrieve files via HTTP or FTP Options: -s Spider mode - only check file existence -c Continue retrieval of aborted transfer -q Quiet -P Set directory prefix to DIR -O Save to filename ('-' for stdout) -U Adjust 'User-Agent' field -Y Use proxy ('on' or 'off')[COMMAND]... Locate a COMMAND Print the user name associated with the current effective user id[OPTIONS] [PROG [ARGS]] Run PROG on every item given by standard input Options: -r Do not run command if input is empty -0 Input is separated by NUL characters -t Print the command on stderr before execution -e[STR] STR stops input processing -n N Pass no more than N args to PROG -s N Pass command line of no more than N bytes -x Exit if size is exceeded[OPTIONS] [STRING] Repeatedly output a line with STRING, or 'y'FILE Uncompress to stdoutBusyBox v1.15.3 (2010-02-28 18:18:44 CET)memory exhaustedinvalid date '%s'write errorread errorcan't create raw socketpermission denied. (are you root?)%s requires an argumentinvalid argument '%s' to '%s'standard inputstandard outputdefault0123456789ABCDEF/dev/null-/bin/shPATH=/sbin:/usr/sbin:/bin:/usr/bin0123456789 123456789LINESCOLUMNSSELinux support is disabledcan't stat '%s'sendtolistenbindcan't open '%s'can't change root directory to %schdir(%s)setuidsetgid%s: I/O errorlseek(%llu)lseekshort writecan't duplicate file descriptorcan't create pipecan't move '%s' to '%s'can't remove file '%s'short readcan't read '%s'.bz2no gzip/bzip2 magicread error from '%s'pollafon:%s: {%s}: %7llo cannot run %s-1+vpCommand terminated by signal %u Command exited with non-zero status %u %\%lu%uh %um %02us%um %u.%02us%u%%?%%%u.%02ureal %E user %u sys %T Command being timed: "%C" User time (seconds): %U System time (seconds): %S Percent of CPU this job got: %P Elapsed (wall clock) time (h:mm:ss or m:ss): %E Average shared text size (kbytes): %X Average unshared data size (kbytes): %D Average stack size (kbytes): %p Average total size (kbytes): %K Maximum resident set size (kbytes): %M Average resident set size (kbytes): %t Major (requiring I/O) page faults: %F Minor (reclaiming a frame) page faults: %R Voluntary context switches: %w Involuntary context switches: %c Swaps: %W File system inputs: %I File system outputs: %O Socket messages sent: %s Socket messages received: %r Signals delivered: %k Page size (bytes): %Z Exit status: %xreal %e user %U sys %S# sethostnamedfisF:vdomaindfqdnffileFbad: '%s'inetSIOC%sSIOCGIFFLAGSSIOCSIFFLAGSmetricmtutxqueuelendstaddrnetmaskbroadcastpointopointarptrailerspromiscmulticastallmultidynamicupdownSIFMETRICSIFMTUSIFTXQLENSIFDSTADDRSIFNETMASKSIFBRDADDRSIFADDRerror: no inet socket availableSIOCGIFCONF/proc/net/devcompressedbytesDevice not found%s: error fetching interface information: %sX bytes:%llu (%llu.%u %sB)%s%-9.9s Link encap:%s HWaddr %s Media:%s(auto) %s addr:%s P-t-P:%s Bcast:%s Mask:%s [NO FLAGS] MTU:%d Metric:%dRX packets:%llu errors:%lu dropped:%lu overruns:%lu frame:%lu compressed:%lu TX packets:%llu errors:%lu dropped:%lu overruns:%lu carrier:%lu collisions:%lu compressed:%lu txqueuelen:%d R TInterrupt:%d Base address:0x%lx Memory:%lx-%lx DMA chan:%x %02X-[NONE SET]%02X:%02X:%02X:%02X:%02X:%02X%n%llu%u%u%u%u%n%n%n%llu%u%u%u%u%u%llu%llu%u%u%u%u%n%n%llu%llu%u%u%u%u%u%llu%llu%u%u%u%u%u%u%llu%llu%u%u%u%u%u%uunknown10base210baseTAUI100baseT100baseTX100baseFXDARPA InternetunspecUNSPECloopLocal LoopbacketherEthernetpppPoint-to-Point ProtocolinfinibandInfiniBandUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARPPROMISCALLMULTISLAVEMASTERMULTICASTKiMiGiTi --- %s ping statistics --- %lu packets transmitted, %lu packets received, %lu duplicates, %lu%% packet loss round-trip min/avg/max = %u.%03u/%u.%03u/%u.%03u ms can't set multicast source interfacerecvfrom (DUP!)%d bytes from %s: seq=%u ttl=%d time=%u.%03u msunknown ICMP typewarning: got ICMP %d (%s)=1:q--v:v--q:c+:w+:W+qvc:s:w:W:I:4PING %s (%s) from %s: %d data bytes Echo ReplyDestination UnreachableSource QuenchRedirect (change route)Echo RequestTime ExceededParameter ProblemTimestamp RequestTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply/proc/net/routeMetric Ref Use MSS Window irttKernel IP routing table Destination Gateway Genmask Flags %s Iface %*[^ ] %63s%lx%lx%X%d%d%d%lx%d%d%d fscanf%-15.15s %-15.15s %-16s%-6s%5d %-5d %6d %s %-6d %-2d %7d %s -net-hostA:neresolving %sgateway %s is a NETWORKnetmask %.8x and host route conflictbogus netmask %snetmask and route address conflictSIOCADDRTSIOCDELRTadddeldelete#net#host metric netmaskgw gatewaymss windowirttdev device reject!mod"dyn #reinstateGHRDMr+fdopenhttp://tcphttpftp://ftpnot an http or ftp url: %s %-20.20s%4d%% |%s%*s|%6d%c - stalled ---:--:-- ETA%02d:%02d:%02d ETA kMGTPEZY%s%s error getting responsebad header line: %sWgetcsqO:P:Y:U:t:T:http_proxyftp_proxyindex.htmlConnecting to %s (%s) htGET %stp://%s/%s HTTP/1.1 GET /%s HTTP/1.1 Host: %s User-Agent: %s Proxy-Authorization: Basic %s Range: bytes=%lld- no response from serverserver returned error: %scontent-length %s is garbagetransfer encoding '%s' is not supportedtoo many redirectionsanonymous:busybox@USER PASS ftp login: %sTYPE ISIZE SIZE value is garbagePASVbad response to %s: %sREST %lldRETR RETRftp error: %sQUITcontent-lengthtransfer-encodingchunkedlocationUnicasting a release of %s to %sdeconfigEntering released stateeth0/usr/share/udhcpc/default.scriptc--C:C--c:O::T+:t+:A+c:CV:H:h:F:i:np:qRr:s:T:t:SA:O:ofbavunknown option '%s'%s (v1.15.3) startedudhcp 1.15.3selectleasefailNo lease, forking to backgroundNo lease, failingLease lost, entering init statePerforming a DHCP renewReceived SIGTERMRead error: %s, reopening socketno message type option, ignoring packetno server ID in messageno lease time with ACK, using 1 hour leaseOffered address is in use (got ARP reply), decliningLease of %s obtained, lease time %uboundReceived DHCP NAKnakclientidcclientid-noneCvendorclassVhostnameHfqdnFinterfaceinownpidfilepquitqreleaseRrequestrscriptstimeoutTversionvretriesttryagainAsyslogSrequest-optionOno-default-optionsoforegroundfbackgroundbarpingabogus packet, malformed option fieldoption 0x%02x did not fit into the packetcannot add option 0x%02xsubnettimezoneroutertimesrvnamesrvdnslogsrvcookiesrvlprsrvhostnamebootsizedomainswapsrvrootpathipttlmtubroadcastnisdomainnissrvntpsrvwinsrequestipleasedhcptypeserveridmessagevendorclassclientidtftpbootfileuserclassstaticrouteswpadsocket(%s)bind(%s)connectUDPPACKETPacket with bad magic, ignoringMSFT 98%s%u.%u.%u.%u%s=noyes%ld/%u interface=%sip=mask=%dsiaddr=boot_file=%ssname=%scannot send signalSO_BROADCASTis interface %s up and configured?SIOCGIFINDEXSIOCGIFHWADDRcannot enable bcast on raw socketSending renew...Sending discover...Sending decline...Sending select for %s...Sending release...bufferssharedfreeusedtotal%6s%13s%13s%13s%13s%13s Mem:%6s%13ld%13ld%13ld%13ld%13ld Swap:%6s%13ld%13ld%13ld Total:unknown signal '%s'bad signal name '%s'you need to specify whom to kill%s: no process killedcannot kill pid %ubad pid '%s'cannot kill pid %d PID USER VSZ STAT COMMAND mgtpezy%5u %-8.8s %s %s %02d:%02d:%02d up %d day%s, %2d:%02d, %d min, load average: %ld.%02ld, %ld.%02ld, %ld.%02ld %s%c (core dumped)Done(%d)DoneYou have stopped jobs. unlimited %lld %ldm%ld.%.3lds%c[%d] Running %*c%d %s%*cline %d: parameter not set or null%.*s: %s%s%.*s: is read only%.*s: bad variable nameOLDPWDcan't set tty process group (%m)/dev/ttycan't access tty; job control turned off%d: %msyntax error: %sunexpected %s (expecting %s)exponent less than 0divide by zeroexpression recursion loop detectedbad fd number"$(...)"$(...)${${#"}$(())>|<<...while && | || if ; then ; else ; fiuntil ; do ; donefor in () { ... }) ;; >>>&<&%s=%s %s: %s not found %s%s%.*s%s missing '))'unterminated quoted stringmissing '}'bad substitutionEOF in backquote substitutionillegal eof marker for << redirectionbad for loop variable-obad function namecan't forkillegal option -%cno arg for -%c optionLPvfNo previous jobNo current job%s: no such job%s: ambiguousjob %s not created under job control -%u[%d] | %sillegal option %co %s%-16s%s set %co %s loginillegal option %c%cinvalid file descriptorp:u:rIFSexpression expected%.4o illegal mode: %sHSatfdscmlpnvwtoo many argumentsbad number%-20s error setting limit (%m)out of file descriptorstrap -- %s %s %s: bad trapCDPATHcan't cd to %sredir errorpipe call failednonexistent directorycan't create %s: %sno such filecan't open %s: %s Use "exit" to leave shell. %builtinfunc%s not defined in %s is a shell keywordalias is an alias for %s a tracked alias for is%s %s is a shell functionspecial is a %sshell builtin: not found %s%s %s: not foundPS1=# PPID/etc/profile.profileENV_eerrexitfnoglobIignoreeofiinteractivemmonitornnoexecsstdinxxtracevverboseCnoclobberaallexportbnotifyunounsetend of file);;`dodoneelifelseesacfithen}3.3:2[2[[6alias2bg3break2cd0chdir3continue3eval3exec3exit7export2false2fg0hash2jobs2kill0let4local2printf0pwd2read7readonly3return3set3shift3source2test3times3trap2true0type0ulimit2umask2unalias3unset2waitREPLYPS1=$ PS2=> PS4=+ @==:HOME    !"$&'()*-/:;<=>?[\]`|}~vinewlineredirectionword;&&&|||(!caseforifinuntilwhile{Illegal number: %sIFS= *?[}-+?=nrbtfavx\01234567 ()&|;  rwxugo   %s <<=>>=<< >>,||&&!=*<=k>=K== |=B&="*=/=#%=C+=-=--3^=b++**/!0< >+=|& */.%N+ --^~,?:$)4(c:nkernelklogd started: %sklogd: error %d in klogctl(2): %mklogd: exitingp:st:facilityunknown %s name: %spriority/dev/console%s.%d%s.%s<%d>%s %.64s %s %s =0m:nO:l:Ss:b:syslogd started: BusyBox v1.15.3read from /dev/logsyslogd exitingalertcritdebugemergerrinfononenoticepanicwarnwarningauthauthprivcrondaemonkernlprmailmarknewssecuritysysloguseruucplocal0local1local2local3local4local5local6local7/var/log/messagess+:n+cs:n:klogctl"%08.8_Ax ""%08.8_ax " 8/1 "%02x " " " 8/1 "%02x " " |" 16/1 "%_p" "|\n""%07.7_ax " 8/2 "%04x " "\n""%07.7_ax " 16/1 "%03o " "\n""%07.7_ax " 16/1 "%3_c " "\n""%07.7_ax " 8/2 " %05u " "\n""%07.7_ax " 8/2 " %06o " "\n""%07.7_ax " 8/2 " %04x " "\n"bcdoxCe:f:n:s:v"%07.7_Ax "%u:%u/block/mknod %s/sys/class/block/sys/block/sys/classACTIONDEVPATHSUBSYSTEMFIRMWARESEQNUMmdev.seq/sys%sremoveaddSetting up swapspace version 1, size = %llu bytes /dev/urandomUUID=%.8s-%.4s-%.4s-%.4s-%.12s SWAPSPACE2--More-- (%d%% of %lld bytes) %*s (Enter:next line Space:next page Q:quit R:show the rest)%s,%.*s%s is write-protected, mounting read-onlyautocannot setup loop devicenodevmounting %s on %s failed?2o::o:t:rwanfvsiO:rwno %s%s on %s type %s (%s) /etc/fstabcannot read %sswapcan't find %s in %sfldnravdt:ican't remount %s read-only%s busy - remounted read-onlyforcibly can't %sumount %serror inflatinginvalid magictgz%s: unknown suffix - ignoredcompressed data not read from terminal, use -f to force itcfvdtncfvdtcfvdtq123456789n%s.gz      bzip2gzipvforkcan't execute '%s'cannot stat tar fileerror exit delayed from previous errorswaitpid--:tt:vv:?:X::T::c:t:x:c--tx:t--cx:x--cttxC:f:Opvkchjzempty archive%s: not found in archive%0*lloustar ././@LongLinkcannot store file '%s' of size %lld, aborting%s: unknown file typeremoving leading '/' from member names%s: socket ignored%s: file is the archive; skipping-d:lnopqxcan't open %s, %s.zip, %s.ZIPArchive: %s Length Date Time Name -------- ---- ---- ----invalid zip magic %08Xunsupported method %dzip flags 1 and 8 are not supported%9u %02u-%02u-%02u %02u:%02u %s creating: %s '%s' exists but is not directoryreplace %s? [y]es, [n]o, [A]ll, [N]one, [r]ename: can't read input'%s' exists but is not regular file inflating: %s inflate errorcrc errorbad lengthnew name: error: invalid response [%c] -------- ------- %9d %d files cannot remove old file %scannot stat old file%s not created: newer or same age file existshardcannot create %slink from %s to %scannot make dir %ssymcannot create node %sunrecognized file typeCRC errorbunzip error %dunexpected end of filecorrupted dataread errorincorrect lengthcc      corrupted octal value in tar headerustarinvalid tar magicinvalid tar header checksumwarning: skipping header '%c'unknown typeflag: 0x%x/../name with '..' encountered: '%s'invalid gzip magic%s %d/%d %9llu %4u-%02u-%02u %02u:%02u:%02u %s -> %sseek failureVT_DISALLOCATEexec %s+c:wslfvcan't find open VT/dev/tty%dVT_GETSTATESHELLc(K[?25hsttysane-2invalid mode: %sRh-i-2:l--s:s--l:Pd:rRd:Rd:apdR:HLpdRfilsLarPHvb--bcf:c--bcf:f--bcfexpected a list of bytes, characters, or fieldsthe delimiter must be a single charactersuppressing non-delimited lines makes sense%sa delimiter may be specified%s,missing list of positionsb:c:f:d:sn only when operating on fieldsTZ=UTC0d--s:s--d:R--I:I--RRs:ud:r:I::D:cannot set date%Y-%m-%d%a, %d %b %Y %H:%M:%S %a %b %e %H:%M:%S %Z %Y%f%Y.%m.%d-%H:%M:%Sdatehoursminutessecondswriting '%s'%llu+%llu records in %llu+%llu records out bscountseekskipifofk-m:m-kkPhmPOSIXLY_CORRECT SizeUse%CapacityFilesystem %-15sUsed Available %s Mounted on %s: can't find mount pointrootfs %-20s %9s %9s %3u%% %s %s-blocks%s %s h-km:k-hm:m-hk:H-L:L-H:s-d:d-s:d+aHkLsxd:lchmneEu::+iu:putenvwarning: '%s': using '^' as the first character of a basic regular expression is not portable; it is ignorednon-numeric argumentdivision by zerosyntax error<===!=>=too few arguments%ld quotelengthmatchindexsubstrn: ==> %s <== ?1:u--g:g--u:G--u:u--G:g--G:G--g:r?ugG:n?ugGrnugG gid= euid= egid= groups=cannot get groupss--d:d--scvbDdpsg:m:o:permissionscan't change %s of %sownershipstrip~sfnbS:##%"%##%$%#%% |/@=%*s%7lu %4llu %-10s %4lu %-8.8s %-8.8s%-8u %-8u%4u, %3u %9llu %24.24s %6.6s %5.5s %4.4s [%u;%um -> %s: T+:w+Cadil1gnsxQAkcetuSXrvFpLRhT:w:alwaysyesforceautottyif-ttycoloralgorithm not supportedscw-%c is meaningful only when verifying checksumsonly one argument may be specified when using -c *%s: OK %s: FAILED WARNING: %d of %d computed checksums did NOT match%s %s m:pinvalid mode '%s'pcub-2:f-i:i-fmv: overwrite '%s'? cannot rename '%s'non-cannot remove '%s'cannot overwrite %sdirectory with %sdirectory%s: invalid number.*usage: printf FORMAT [ARGUMENT...]-+ #%s: invalid formatdiouxXfeEgGcsfiRrvcannot remove '.' or '..'+ws:%s%0*.*fbad field specificationunknown sort type%bo--o:t--t:k::bad -t parameterunknown key optionCheck line %d ngMucszbrdfimS:T:o:k:t:^-undef%d %d rows %d; columns %d;%lx:%lx:%lx:%lx%n:%x%nonly one device may be specified-Finvalid argument '%s'verbose and stty-readable output styles are mutually exclusivemodes may not be set when specifying an output style%s: cannot reset non-blocking mode%s: cannot perform all requested operations%lx:%lx:%lx:%lx:%x%s = %s;min = %d; time = %d;-%s%s%s: no size information for this device%lu speed %lu baud;%lu %lu ispeed %lu baud; ospeed %lu baud; linerowscolscolumnssizespeedispeedospeedfc:n:no files ==> %s <== iawaout of rangeargument expectedclosing paren expectedmissing ]missing ]]%s: unknown operand-r-w-x-e-f-d-c-b-p-u-g-k-s-t-z-n-h-O-G-L-S===!=<>-eq-ne-ge-gt-le-lt-nt-ot-ef!-a-o()cfma+CcdsSTRING2 cannot be emptynot a ttyGNU/Linuxsnrvmpioaallakernel-namesnodenamenkernel-releaserreleaserkernel-versionvmachinemprocessorphardware-platformioperating-systemorw%ld f+:s+:w+cduf:s:w:lwcL %9ucannot stat '%s'?1dqtp:tmp.XXXXXXTMPDIR/tmp/-1:?2:l--s:s--lsl%.0s%.0s%lld %3o %3o %s %s differ: char %lld, line %d cmp: EOF on %s unmatched '%c'bad format in substitution expressionempty filename%s %s no address after commamissing commandbad option in substitution expressionaiconly a beginning address can be specified for edit commandscommand only uses one address:btTdDgGhHlnNpPqx={}unsupported command %cunterminated {no previous regexpcan't find label for jump to '%s'--versionThis is not GNU sed version 4.0e::f::nnirne:f:%sXXXXXXcannot create temp file %s; These features are available: Pattern searches with / and ? Last command repeat with '.' Line marking with 'x Named buffers with "x Readonly if vi is called as "view" Readonly with -R command line arg Some colon mode commands with ':' Settable options with ":set" Signal catching- ^C Job suspend and resume with ^Z Adapt to window re-sizes"%s" %s"%s" Not a regular fileTrying to insert file outside of memorycannot read all of file "%s"Put %d lines (%d chars) from [%c](NULL)^$'%s' is not implementedNo current filenamecan't read user inputlast_modifying_cmd overrun%d%n  [Modified] [Readonly]No file%c %s%s%s %d/%d %d%%[Hit return to continue])]} shell returned %i deleteNo write since last change (:edit! overrides) [New file]"%s"%s%s %dL, %dCNo address allowed on this commandfeatureslist$ quitnextNo write since last change (:%s! overrides)%d more file to editNo more files to editNo filename given"%s"%s %dL, %dCrewindNo write since last change (:rewind! overrides)all---------------------------------------- autoindent flash ignorecase showmatch tabstop=%d aifltabstop=%d1.15.3 2010-02-28 18:18:44 CETwq"%s" File is read only"%s" %dL, %dCyankYank %d lines (%d chars) into [%c]:s expression missing delimitersNothing in register %c()[]{}Pattern not foundsearch hit TOP, continuing at BOTTOMsearch hit BOTTOM, continuing at TOPWrite error: %swW^0bBeEft%$ lhcdykjHL+-{} ChangeDeleteYank%s %d lines (%d chars) using [%c]%d%cEXINIThCRHc:cdy><^%$0bBeEfthH-k{L+j} ^0bBh[%d;%dH -IR--exec CMD must end by ';'unpaired '('-typeunrecognized: %s-follow-xdev-mindepth-maxdepth-a-o!-print-print0-depth-prune-exec(-name-iname-path-regex-type-perm-mtime-mmin-user-group-size%i%c%s:H-h:C-AB:e::f::m+:A+:B+:C+lnqvscFiHhe:f:Lorm:A:B:C:EaI(standard input)+trn:s:e::E:x0echocannot fit single argument within argument list size limitargument list too long%s: exited with status 255; aborting%s: terminated by signal %dargument line too longdoublesingleunmatched %s quotehprd:nfwilinuxrc can't log to %srebootumount -a -rswapoff -ainit/dev/tty2/dev/tty3/dev/tty4/etc/init.d/rcS/dev/Bad inittab entry at line %d#:~`!$^&*()=|\{}[];"'<>?exec -/bin/shcannot run '%s': %sstarting pid %d, tty '%s': '%s'reloading /etc/inittab-qCONSOLETERM=vt102TERM=linuxHOME=/SHELL=/bin/shUSER=rootRUNLEVELinit started: %sLow memory, forcing swaponmount -t proc proc /procswapon -aprocess '%s' (pid %d) exited. Scheduling for restart.The system is going down NOW!Sent SIG%s to all processesKILLpoweroffhaltRequesting system %s/dev/tty5sysinitwaitoncerespawnaskfirstctrlaltdelshutdownrestart Please press Enter to activate this console. unknown gid %uunknown uid %uunknown group %sunknown user %s%s%s%s%s: overwrite '%s'? cannot create '%s''%s' and '%s' are the same filerecursion detected, omitting directory '%s'target '%s' is not a directorycannot create directory '%s'cannot preserve %s of '%s'cannot create link '%s'cannot close '%s'cannot create symlink '%s'unrecognized file '%s' with mode %xbad format {%s}bad byte count for conversion character %seEfgG%%s requires a precision or a byte countbad conversion character %%%sbyte count with multiple conversion characters -0+#%03odel\0\a\b \b \n \r \t \v.#-+ 0123456789cdiouxXeEfgGdiouxXnulsohstxetxeotenqackbelbs_ht_lf_vt_ff_cr_so_si_dledcldc2dc3dc4naksynetbcanem_subescfs_gs_rs_usVT_ACTIVATEVT_WAITACTIVEcan't open console/dev/tty0%llu%*c%llu.%d%c%lluKMGTPE[%uD [%dA[%dC `"#$%^&*()=+{}[]:;'|\<>[%uA%s%-*sENVBASH_ENVHOMEIFSSHELLLD_LIBRARY_PATHLD_PRELOADLD_TRACE_LOADED_OBJECTSLD_BIND_NOWLD_AOUT_LIBRARY_PATHLD_AOUT_PRELOADLD_NOWARNLD_KEEPDIR/dev/loop%d%ld %screateset permissions ofcannot %s directory '%s'                  /proc/mountsbad line %u: %d tokens found, %d neededrwxXstaugoabfnrtv\ \\/proc/%u/cmdline[%s]/proc/%u/stat%c %u %u %u %d %*s %*s %*s %*s %*s %*s %lu %lu %*s %*s %*s %ld %*s %*s %lu %lu %lu exeOOOOOO[[[[[[[1[2[3[4[5[6[7[8%s: is a directory%s: descend into directory '%s'? %s: remove directory '%s'? %s: remove '%s'? clock_gettime(MONOTONIC) failed%u.%u.%u-%u:%u%c%u-%u-%u %u:%u%c%2u%2u%2u%2u%2u%c%4u%2u%2u%2u%2u%cSIGABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/= ignoring all argumentsnumber %s is not in %llu..%llu rangeinvalid number '%s'number %s is not in %lld..%lld range%s:%sbad port spec '%s'bad address '%s'cannot connect to remote hostcan't bind to interface %sgetcwdnot a symlink%s: cannot read link: %sbad regex '%s': %sunknown user/group %s;(VDWdLYTZzR| gxxmuj,jpppppp tE@v=! =